spacer

EBI Dbfetch

ID   HM357877; SV 1; linear; genomic DNA; STD; HUM; 4272 BP.
XX
AC   HM357877;
XX
DT   27-JUN-2010 (Rel. 105, Created)
DT   27-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*310102 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4272
RA   Xu Y., Deng Z., Yang B.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-4272
RA   Xu Y., Deng Z., Yang B.;
RT   ;
RL   Submitted (26-MAY-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2 Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 013cd8bb703181aba43638ca9244defe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4272
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: actcagagctawggaatgatg, rev_seq:
FT                   atggagcagcaaagatgac"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>4272
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
FT   misc_feature    <1..822
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<823..895,1025..1294,1536..1811,2412..2687,2787..2903,
FT                   3344..3376,3519..3566,3736..>4272)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
FT                   /product="MHC class I antigen"
FT   CDS             join(823..895,1025..1294,1536..1811,2412..2687,2787..2903,
FT                   3344..3376,3519..3566,3736..3740)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein"
FT                   /db_xref="GOA:Q2MJJ6"
FT                   /db_xref="IMGT/HLA:A*31:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2MJJ6"
FT                   /protein_id="ADI95505.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   3'UTR           3741..>4272
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
XX
SQ   Sequence 4272 BP; 894 A; 1166 C; 1244 G; 968 T; 0 other;
     gtaaatttaa aatactacaa gcaggagtca caggtacatt gtctgggaaa gtgaaactta        60
     gtagctttgt gagtcctgtt gtaaggctgt tggacacatt tatacatcaa ggggccaaag       120
     tcacattttt tacctattag attcctgatc attcaggggt taccaagatt ctgctaccca       180
     ctgtagttaa taaacaaaga gcaaattggt ctctattctg tctcatgcac tcaggcgcaa       240
     cttttcccga ttaaaaacaa aaacaacaac aacaaaaatc tacacctcca ttcccagagc       300
     aatcttactc tctggcacca aactccatgg ggtgattttt cttctagaag agtccaggtg       360
     gacaggtaag gagtgggagt cagggagtcc agttcaggga cagagattac gggatgaaaa       420
     gtgaaaggag agggacgggg cccatgccca gggtttctcc cttgtttctc agacagctct       480
     tgggccaaga ctcagggaga cattgagaca gagcgcttgg cacaggagca gaggggtcag       540
     ggcgaagtac cagggcccca ggcgtggctc tcagggtctc aggccccgaa ggcggtgtat       600
     ggattgggga gtcccagcct tggggattcc ccaactccgc agtttctttt ctccctctcc       660
     caacctatgt agggtccttc ttcctggata ctcacgacgc ggacccagtt ctcactccca       720
     ttgggtgtcg ggtttccaga gaagccaatc agtgtcgtcg cggtcgcggt tctaaagtcc       780
     gcacgcaccc accgggactc agattctccc cagacgccga ggatggccgt catggcgccc       840
     cgaaccctcc tcctgctact cttgggggcc ctggccctga cccagacctg ggcgggtgag       900
     tgcggggtcg tggggaaacc gcctctgcgg ggagaagcaa ggggcccgcc cggcgggggc       960
     gcaggacccg ggtagccgcg ccgggaggag ggtcgggcgg atctcagcca ctcctcgccc      1020
     ccaggctccc actccatgag gtatttcacc acatccgtgt cccggcccgg ccgcggggag      1080
     ccccgcttca tcgccgtggg ctacgtggac gacacgcagt tcgtgcggtt cgacagcgac      1140
     gccgcgagcc agaggatgga gccgcgggcg ccgtggatag agcaggagag gcctgagtat      1200
     tgggaccagg agacacggaa tgtgaaggcc cactcacaga ttgaccgagt ggacctgggg      1260
     accctgcgcg gctactacaa ccagagcgag gccggtgagt gaccccagcc cggggcgcag      1320
     gtcacgacct ctcatccccc acggacgggc caggtcaccc acagtctccg ggtccgagat      1380
     ccaccccgaa gccgcgggac cccgagaccc ttgccccggg agaggcccag gcgcctttac      1440
     ccggtttcat tttcagttta ggccaaaaat ccccccgggt tggtcggggc cggacggggc      1500
     tcgggggact gggctgaccg tggggtcggg gccaggttct cacaccatcc agatgatgta      1560
     tggctgcgac gtggggtcgg acgggcgctt cctccgcggg taccagcagg acgcctacga      1620
     cggcaaggat tacatcgcct tgaacgagga cctgcgctct tggaccgcgg cggacatggc      1680
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagt tgagagccta      1740
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct      1800
     gcagcgcacg ggtaccaggg gccacggggc gcctccctga tcgcctgtag atctcccggg      1860
     ctggcctccc acaaggaggg gagacaattg ggaccaacac tagaatatca ccctccctct      1920
     ggtcctgagg gagaggaatc ctcctgggtt tccagatcct gtaccagaga gtgactctga      1980
     ggttccgccc tgctctgtga cacaattaag ggataaaatc tctgaaggaa tgacgggaag      2040
     acgatccctc gaatactgat gagtggttcc ctttgacaca caccggcagc agccttgggc      2100
     ccgtgacttt tcctctcagg ccttgttctc tgcttcacac tcaatgtgtg tgggggtctg      2160
     agtccagcac ttctgagtcc ctcagcctcc actcaggtca ggaccagaag tcgctgttcc      2220
     ctcttcaggg actagaattt tccacggaat aggagattat cccaggtgcc tgtgtccagg      2280
     ctggtgtctg ggttctgtgc tcccttcccc atcccaggtg tcctgtccat tctcaagata      2340
     gccacatgtg tgctggagga gtgtcccatt acagatgcaa aatgcctgaa tgttctgact      2400
     cttcctgaca gaccccccca agacgcatat gactcaccac gctgtctctg accatgaggc      2460
     caccctgagg tgctgggccc tgagcttcta ccctgcggag atcacactga cctggcagcg      2520
     ggatggggag gaccagaccc aggacacgga gctcgtggag accaggcctg caggggatgg      2580
     aaccttccag aagtgggcgt ctgtggtggt gccttctgga caggagcaga gatacacctg      2640
     ccatgtgcag catgagggtc tccccaagcc cctcaccctg agatggggta aggagggaga      2700
     tgggggtgtc atgtctttta gggaaagcag gagcctctct gacctttagc agggtcaggg      2760
     cccctcacct tcccctcttt tcccagagcc gtcttcccag cccaccatcc ccatcgtggg      2820
     catcattgct ggcctagttc tctttggagc tgtgttcgct ggagctgtgg tcgctgctgt      2880
     gaggtggagg aggaagagct caggtggggt gaaggggtga agggtgggtc tgagatttct      2940
     tgtctcactg agggttccaa gacccaggta gaagtgtgcc ctgcctcgtt actgggaagc      3000
     accatccaca attatgggcc tacccagcct gggccctgtg tgccagcact tactcttttg      3060
     taaagcacct gttaaaatga aggacagatt tatcaccttg attatggcgg tgatgggacc      3120
     tgatcccagc agtcacaagt cacaggggaa ggtccctgag gaccttcagg agggcggttg      3180
     gtccaggacc cacacctgct ttcttcatgt ttcctgatcc cgccctgggt ctgcagtcac      3240
     acatttctgg aaacttctct gaggtccaag acttggaggt tcctctagga ccttaaggcc      3300
     ctggctcctt tctggtatct cacaggacat tttcttccca cagatagaaa aggagggagc      3360
     tactctcagg ctgcaagtaa gtatgaagga ggatgatcca agaaatcact gggatattgt      3420
     gtttgggagc ccgtggggga gctcacccac cccacaattc ctcctctagc cacatcttct      3480
     gtgggatctg accaggttct gtttttgtcc taccccaggc agtgacagtg cccagggctc      3540
     tgatatgtct ctcacagctt gtaaaggtga gagcctggag ggcctgatgt gtgttgggtg      3600
     ttgggcggaa cagtggacgc agctgtgcta tggggtttct ttgcattgga tgtattgagc      3660
     atgcgatggg ctgtttaaag tgtgactcct cactgtgaca gatacgaatt tgttcatgaa      3720
     tatttttttc tatagtgtga gacagctgcc ttgtgtggga ctgagaggca agatttgttc      3780
     ctgcccttcc ctttgtgact tgaagtaccc tgactttgtt tctgcaaagg cacctgcatg      3840
     tgtctgtgtt cttgtaggca taatgtgagg aggtggggag accaccccac ccccatgtcc      3900
     accatgaccc tcttcccacg ctgacctgtg ctccctcccc aatcatcttt cctgttccag      3960
     agaggtgggg ctgaggtgtc tccatctctg cctcaacttc atggtgcact gagctgtaac      4020
     ttcttccttc cctattaaaa ttagaacctg agtataaatt tactttctca aattcttgcc      4080
     atgagaggtt gatgagttaa ttaaaggaga agattcctaa aatttgagag acaaaataaa      4140
     tggaacacat gagaaccttc cagagtccac gtgttgctta tgctgatttg ttgcagggga      4200
     ggagagtaga tggggctgtg cccagtttct gttccggcca ccatgggctt tatgtggtca      4260
     ctgcttagct gg                                                          4272
//


spacer
spacer