spacer

EBI Dbfetch

ID   HM357875; SV 1; linear; genomic DNA; STD; HUM; 4255 BP.
XX
AC   HM357875;
XX
DT   27-JUN-2010 (Rel. 105, Created)
DT   27-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*300101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4255
RA   Xu Y., Deng Z., Yang B.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-4255
RA   Xu Y., Deng Z., Yang B.;
RT   ;
RL   Submitted (26-MAY-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2 Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4255
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: actcagagctawggaatgatg, rev_seq:
FT                   atggagcagcaaagatgac"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>4255
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT   misc_feature    <1..820
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<821..893,1024..1293,1535..1810,2390..2665,2768..2884,
FT                   3327..3359,3502..3549,3719..>4255)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /product="MHC class I antigen"
FT   CDS             join(821..893,1024..1293,1535..1810,2390..2665,2768..2884,
FT                   3327..3359,3502..3549,3719..3723)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein"
FT                   /db_xref="GOA:Q2LC93"
FT                   /db_xref="IMGT/HLA:A*30:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2LC93"
FT                   /protein_id="ADI95503.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARWAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   3'UTR           3724..>4255
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
XX
SQ   Sequence 4255 BP; 892 A; 1155 C; 1247 G; 961 T; 0 other;
     gcaaatttaa agtaagacaa gcaggagtca cagatacatt gtctgggaaa gtgcaactta        60
     gtagctttgt gagtcctgtt gtaatgcttt tggacacatt tatacattaa ggggccaaag       120
     tcacattttt ttacctatta gattcctgat cattcagggg ttaccaagat tctgctaccc       180
     actgtagtta ataaacaaag agcaaattgg tctctattct gtctcatgca ctcaggcaca       240
     acttttccgg attaaaaaca aaaacaacaa caaaaatcta cacctccatt cccagagcaa       300
     gcttactctc tggcaccaaa ctccatgggg tgatttttct tctagaagag tccaggtgga       360
     caggtaagga gtgggagtca gggagtccag ttcagggaca gagataatgg gatgaaaagt       420
     gaaaggagag ggacggggcc catgccgagg gtttctccct tgtttctcag acagctcttg       480
     ggccaagact cagggagaca ttgagacaga gcgcttcgca caggagcaga ggggtcaggg       540
     cgaagtccca gggccccagg cgtggctctc agggtctcag gccccgaagg cggtgtatgg       600
     attggggagt cacagccttg gggattcccc aactccgcag tttcttttct ccctctccca       660
     acctacgtag ggtccttcat cctggatact cacgacgcgg acccagttct cactcccatt       720
     gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg gtcgctgttc taaagcccgc       780
     acgcacccac cgggactcag attctcccca gacgccgagg atggccgtca tggcgccccg       840
     aaccctcctc ctgctactct cgggggccct ggccctgacc cagacctggg cgggtgagtg       900
     cggggtcggg agggaaaccg cctctgcggg gagaagcaag gggccctcct ggcgggggcg       960
     caggaccggg ggagccgcgc cgggaggagg gtcggtcagg tctcagccac tgctcgcccc      1020
     caggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc agtggagagc      1080
     cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg      1140
     ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg cctgagtatt      1200
     gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg gacctgggga      1260
     ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccggccg ggggcgcagg      1320
     tcacgacccc tcatccccca cggacgggcc aggtcgccca cagtctccgg gtccgagatc      1380
     caccccgaag ccgcgggacc ccgagaccct tgacccggga gaggcccagg cgcctttacc      1440
     cggtttcatt ttcagtttag gccaaaaatt cccccgggtt ggtcggggct gggcggggct      1500
     cgggggactg ggctgaccgc ggggtcgggg ccaggttctc acaccatcca gataatgtat      1560
     ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt atgaacagca cgcctacgac      1620
     ggcaaggatt acatcgccct gaacgaggac ctgcgctctt ggaccgcggc ggacatggcg      1680
     gctcagatca cccagcgcaa gtgggaggcg gcccgttggg cggagcagtt gagagcctac      1740
     ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg      1800
     cagcgcacgg gtaccagggg ccacggggcg ccttcctgat cgcctgtaga tctcccgggc      1860
     tggcctccca caaggagggg agacaattgg gaccaacact agaatatcac cctccctctg      1920
     gtcctgaggg agaggaatcc tcctgggttt ccagatcctg taccagagag tgactctgag      1980
     gttccgccct gctctctgac acaattaagg gataaaatct ctgaaggagt gacgggaaga      2040
     cgatccctcg aatactgatg agtggttccc tttgacaccg gcagcagcct tgggcccgtg      2100
     acttttcctc tcaggccttg ttctctgctt cacactcaat gtgtgtgggg gtctgagtcc      2160
     agcacttctg agtccctcag cctccactca ggtcaggacc agaagtcgct gttcccttct      2220
     cagggaatag aagattatcc caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc      2280
     tcttccccat cccgggtgtc ctgtccattc tcaagatggc cacatgcgtg ctggtggagt      2340
     gtcccatgac agatgcaaaa tgcctgaatt ttctgactct tcccgtcaga cccccccaag      2400
     acacatatga cccaccaccc catctctgac catgaggcca ccctgaggtg ctgggccctg      2460
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag      2520
     gacacggagc tcgtggagac caggcctgca ggggatggaa ccttccagaa gtgggcggct      2580
     gtggtggtgc cttctggaga ggagcagaga tacacctgcc atgtgcagca tgagggtctg      2640
     cccaagcccc tcaccctgag atggggtaag gagggagatg ggggtgtcat gtctcttagg      2700
     gaaagcagga gcctctctgg agacctttag cagggtcagg gcccctcacc ttcccctctt      2760
     ttcccagagc tgtcttccca gcccaccatc cccatcgtgg gcatcattgc tggcctggtt      2820
     ctccttggag ctgtgatcac tggagctgtg gtcgctgccg tgatgtggag gaggaagagc      2880
     tcaggtggag aaggggtgaa gggtggggtc tgagatttct tgtctcactg agggttccaa      2940
     gccccagcta gaaatgtgcc ctgtctcatt actgggaagc accatccaca atcatgggcc      3000
     tacccagcct gggccctgtg tgccagcact tactcttttg taaagcacct gttaaaatga      3060
     aggacagatt tatcaccttg attacggcgg tgatgggacc tgatcccagc agtcacaagt      3120
     cacaggggaa ggtccctgag gacagacctc aggagggcta ttggtccagg acccacacct      3180
     gctttcttca tgtttcctga tcccgccctg ggtctgcagt cacacatttc tggaaacttc      3240
     tctggggtcc aagactagga ggttcctcta ggaccttaag gccctggctc ctttctggta      3300
     tctcacagga cattttcttc tcacagatag aaaaggaggg agttacactc aggctgcaag      3360
     taagtatgaa ggaggctgat gcctgaggtc cttgggatat tgtgtttggg agcccatggg      3420
     ggagctcacc caccccacaa ttcctcctct agccacatct tctgtgggat ctgaccaggt      3480
     tctgtttttg ttctacccca ggcagtgaca gtgcccaggg ctctgatgtg tctctcacag      3540
     cttgtaaagg tgagagcttg gaggacctaa tgtgtgttgg gtgttgggcg gaacagtgga      3600
     cacagctgtg ctatggggtt tctttgcatt ggatgtattg agcatgcgat gggctgttta      3660
     aggtgtgacc cctcactgtg atggatatga atttgttcat gaatattttt ttctatagtg      3720
     tgagacagct gccttgtgtg ggactgagag gcaagagttg ttcctgccct tccctttgtg      3780
     acttgaagaa ccctgacttt gtttctgcaa aggcacctgc atgtgtctgt gttcgtgtag      3840
     gcataatgtg aggaggtggg gagaccaccc cacccccatg tccaccatga ccctcttccc      3900
     acgctgacct gtgctccctc cccaatcatc tttcctgttc cagagaggtg gggctgaggt      3960
     gtctccatct ctgtctcaac ttcatggtgc actgagctgt aacttcttcc ttccctatta      4020
     aaattagaac ctgagtataa atttactttc tcaaattctt gccatgagag gttgatgagt      4080
     taattaaagg agaagattcc taaaatttga gagacaaaat aaatggaaga catgagaacc      4140
     ttccagagtc cacgtgtttc ttgtgctgat ttgttgcagg ggaggagagt agatggggct      4200
     gtgcccagtt tctgttctgg ccaccatggg ctttatgtgg tcacagctca cctgg           4255
//


spacer
spacer