spacer

EBI Dbfetch

ID   HM357867; SV 1; linear; genomic DNA; STD; HUM; 4256 BP.
XX
AC   HM357867;
XX
DT   27-JUN-2010 (Rel. 105, Created)
DT   27-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0302 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4256
RA   Xu Y., Deng Z., Yang B.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-4256
RA   Xu Y., Deng Z., Yang B.;
RT   ;
RL   Submitted (25-MAY-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2 Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; b8af045697d8b2cd949c736f7c76e4ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4256
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: actcagagctawggaatgatg, rev_seq:
FT                   atggagcagcaaagatgac"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>4256
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
FT   misc_feature    <1..822
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<823..895,1026..1295,1537..1812,2391..2666,2769..2885,
FT                   3328..3360,3503..3550,3720..>4256)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
FT                   /product="MHC class I antigen"
FT   CDS             join(823..895,1026..1295,1537..1812,2391..2666,2769..2885,
FT                   3328..3360,3503..3550,3720..3724)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein"
FT                   /db_xref="GOA:C5IWY0"
FT                   /db_xref="IMGT/HLA:A*03:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IWY0"
FT                   /protein_id="ADI95495.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   3'UTR           3725..>4256
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0302"
XX
SQ   Sequence 4256 BP; 889 A; 1164 C; 1249 G; 954 T; 0 other;
     gcaaatttaa agtaagacaa gcaggagtca cagatacatt gtctgggaaa gtgcaactta        60
     gtagctttgt gagtcctgtt gtaatgcttt tggacacatt tatacattaa ggggccaaag       120
     tcacattttt tacctattag attcctgatc attcaggggt taccaagatt ctgctaccca       180
     ctgtagttaa taaacaaaga gcaaattggt ctctattctg tctcatgcac tcaggcacaa       240
     cttttccgga ttaaaaacaa aaacaacaac aacaaaaatc tacacctcca ttcccagatc       300
     aagcttactc tctggcacca aactccatgg ggtgattttt cttctagaag agtccaggtg       360
     gacaggtaag gagtgggagt cagggagtcc agttcaggga cagagataat gggatgaaaa       420
     gtgaaaggag agggacgggg cccatgccga gggtttctcc cttgtttctc agacagctcc       480
     tgggccaaga ctcagggaga cattgagaca gagcgcttcg cacaggagca gaggggtcag       540
     ggcgaagtcc cagggcccca ggcgtggctc tcagagtctc aggccccgaa ggcggtgtat       600
     ggattgggga gtcccagcct tggggattcc ccaactccgc agtttctttt ctccctctcc       660
     caacctacgt agggtccttc atcctggata ctcacgacgc ggacccagtt ctcactccca       720
     ttgggtgtcg ggtttccaga gaagccaatc agtgtcgtcg cggtcgctgt tctaaagccc       780
     gcacgcaccc accgggactc agattctccc cagacgccga ggatggccgt catggcgccc       840
     cgaaccctcc tcctgctact ctcgggggcc ctggccctga cccagacctg ggcgggtgag       900
     tgcggggtcg ggagggaaac cgcctctgcg gggagaagca aggggccctc ctggcggggg       960
     cgcaggaccg ggggagccgc gccgggacga gggtcgggca ggtctcagcc actgctcgcc      1020
     cccaggctcc cactccatga ggtatttctt cacatccgtg tcccggcccg gccgcgggga      1080
     gccccgcttc atcgccgtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga      1140
     cgccgcgagc cagaggatgg agccgcgggc gccgtggata gagcaggagg ggccggagta      1200
     ttgggaccag gagacacgga atgtgaaggc ccagtcacag actgaccgag tggacctggg      1260
     gaccctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc cgggggcgca      1320
     ggtcaggacc cctcatcccc cacggacggg ccaggtcgcc cacagtctcc gggtccgaga      1380
     tccaccccga agccgcggga ccccgagacc cttgccccgg gagaggccca ggcgccttta      1440
     cccggtttca ttttcagttt aggccaaaaa tccccccggg ttggtcgggg ctgggcgggg      1500
     ctcgggggac tgggctgacc gcggggtcgg ggccaggttc tcacaccatc cagataatgt      1560
     atggctgcga cgtggggtcg gacgggcgct tcctccgcgg gtaccggcag gacgcctacg      1620
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ttggaccgcg gcggacatgg      1680
     cggctcagat caccaagcgc aagtgggagg cggcccatgt ggcggagcag cagagagcct      1740
     acctggatgg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc      1800
     tgcagcgcac gggtaccagg ggccacgggg cgcctccctg atcgcctgta gatctcccgg      1860
     gctggcctcc cacaaggagg ggagacaatt gggaccaaca ctagaatatc accctccctc      1920
     tggtcctgag ggagaggaat cctcctgggt tccagatcct gtaccagaga gtgactctga      1980
     ggttccgccc tgctctctga cacaattaag ggataaaatc tctgaaggag tgacgggaag      2040
     acgatccctc gaatactgat gagtggttcc ctttgacacc ggcagcagcc ttgggcccgt      2100
     gacttttcct ctcaggcctt gttctctgct tcacactcaa tgtgtgtggg ggtctgagtc      2160
     cagcacttct gagtccctca gcctccactc aggtcaggac cagaagtcgc tgttcccttc      2220
     tcagggaata gaagattatc ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct      2280
     ctcttcccca tcccgggtgt cctgtccatt ctcaagatgg ccacatgcgt gctggtggag      2340
     tgtcccatga cagatgcaaa atgcctgaat tttctgactc ttcccgtcag acccccccaa      2400
     gacacatatg acccaccacc ccatctctga ccatgaggcc accctgaggt gctgggccct      2460
     gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg accagaccca      2520
     ggacacggag ctcgtggaga ccaggcctgc aggggatgga accttccaga agtgggcggc      2580
     tgtggtggtg ccttctggag aggagcagag atacacctgc catgtgcagc atgagggtct      2640
     gcccaagccc ctcaccctga gatggggtaa ggagggagat gggggtgtca tgtctcttag      2700
     ggaaagcagg agcctctctg gagaccttta gcagggtcag ggcccctcac cttcccctct      2760
     tttcccagag ctgtcttccc agcccaccat ccccatcgtg ggcatcattg ctggcctggt      2820
     tctccttgga gctgtgatca ctggagctgt ggtcgctgcc gtgatgtgga ggaggaagag      2880
     ctcaggtgga gaaggggtga agggtggggt ctgagatttc ttgtctcact gagggttcca      2940
     agccccagct agaaatgtgc cctgtctcat tactgggaag caccgtccac aatcatgggc      3000
     ctacccagtc tgggccctgt gtgccagcac ttactctttt gtaaagcacc tgttaaaatg      3060
     aaggacagat ttatcacctt gattacggcg gtgatgggac ctgatcccag cagtcacaag      3120
     tcacagggga aggtccctga ggacagacct caggagggct attggtccag gacccacacc      3180
     tgctttcttc atgtttcctg atcccgccct gggtctgcag tcacacattt ctggaaactt      3240
     ctctggggtc caagactagg aggttcctct aggaccttaa ggccctggct cctttctggt      3300
     atctcacagg acattttctt ctcacagata gaaaaggagg gagttacact caggctgcaa      3360
     gtaagtatga aggaggctga tgcctgaggt ccttgggata ttgtgtttgg gagcccatgg      3420
     gggagcccac ccacctcaca attcctcctc tagccacatc ttctgtggga tctgaccagg      3480
     ttctgttttt gttctacccc aggcagtgac agtgcccagg gctctgatgt gtccctcaca      3540
     gcttgtaaag gtgagagctt ggaggaccta atgtgtgttg ggtgttgggc ggaacagtgg      3600
     acacagctgt gctatggggt ttctttgcat tggatgtatt gagcatgcga tgggctgttt      3660
     aaggtgtgac ccctcactgt gatggatatg aatttgttca tgaatatttt tttctatagt      3720
     gtgagacagc tgccttgtgt gggactgaga ggcaagagtt gttcctgccc ttccctttgt      3780
     gacttgaaga accctgactt tgtttctgca aaggcacctg catgtgtctg tgttcgtgta      3840
     ggcataatgt gaggaggtgg ggagaccacc ccacccccat gtccaccatg accctcttcc      3900
     cacgctgacc tgtgctccct ccccaatcat ctttcctgtt ccagagaggt ggggctgagg      3960
     tgtctccatc tctgtctcaa cttcatggtg cactgagctg taacttcttc cttccctatt      4020
     aaaattagaa ccttagtata aatttacttt ctcaaattct tgccatgaga ggttgatgag      4080
     ttaattaaag gagaagattc ctaaaatttg agagacaaaa taaatggaag acatgagaac      4140
     cttccagagt ccacgtgttt cttgtgctga tttgttgcag gggaggagag tagatggggc      4200
     tgtgcccagt ttctgttctg gccaccatgg gctttatgtg gtcacagctc acctgg          4256
//


spacer
spacer