spacer

EBI Dbfetch

ID   HM347714; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HM347714;
XX
DT   29-SEP-2010 (Rel. 106, Created)
DT   29-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*73var allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Recker K., Fuerst D., Mytilineos J.;
RT   "A new variant of HLA-B*73";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Recker K., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (21-MAY-2010) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; 208facc4f5dd92426decee5d2594bf9e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*73var"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*73var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*73var"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen"
FT                   /db_xref="GOA:E2GF01"
FT                   /db_xref="IMGT/HLA:B*73:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E2GF01"
FT                   /protein_id="ADN84734.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKAKAQTDRVGLRNLRGYYNQSEDGSHTWQTMYGCDMGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLESEC
FT                   VEWLRRHLENGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 110 A; 168 C; 195 G; 73 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcctggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctgc aaggccaagg cacagactga ccgagtgggc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacatggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agagcgagtg cgtggagtgg       600
     ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer