spacer

EBI Dbfetch

ID   HM347431; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HM347431;
XX
DT   04-JUL-2010 (Rel. 105, Created)
DT   04-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Jia Y., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Gao S.,
RA   Gong Z., Zhao B., Zhang K., Wang D., Cui S., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Jia Y., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Gao S.,
RA   Gong Z., Zhao B., Zhang K., Wang D., Cui S., Zhang Z.;
RT   ;
RL   Submitted (21-APR-2010) to the INSDC.
RL   HLA Lab, Bejing Red Cross Blood Center, No. 37 Beisanhuan Zhong Road,
RL   Beijing 100088, China
XX
DR   MD5; be6fa12026f61d99aa8d1c5d58241ff2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9J2F0"
FT                   /db_xref="IMGT/HLA:B*38:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:D9J2F0"
FT                   /protein_id="ADJ54150.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRENLRIALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 86 C; 89 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer