Dbfetch

ID   HM347430; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   HM347430;
XX
DT   04-JUL-2010 (Rel. 105, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1111/tan.12088.
RX   PUBMED; 23527687.
RA   Li D.M., Shan X.Y., Ni L., Wang L., Zhang Z.X.;
RT   "Sequence-based typing identified a new HLA-B*40 allele, HLA-B*40:124:02";
RL   Tissue Antigens 81(6):464-465(2013).
XX
RN   [2]
RP   1-276
RA   Zhang K., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Gao S.,
RA   Gong Z., Zhao B., Jia Y., Wang D., Cui S., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Zhang K., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Gao S.,
RA   Gong Z., Zhao B., Jia Y., Wang D., Cui S., Zhang Z.;
RT   ;
RL   Submitted (21-APR-2010) to the INSDC.
RL   HLA Lab, Bejing Red Cross Blood Center, No. 37 Beisanhuan Zhong Road,
RL   Beijing 100088, China
XX
DR   MD5; 7fd1b65a11d9a5ced10b272253cf2ee2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9J2E9"
FT                   /db_xref="IMGT/HLA:B*40:124:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9J2E9"
FT                   /protein_id="ADJ54149.1"
FT                   /translation="SHTLQRMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 276 BP; 52 A; 86 C; 102 G; 36 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggtacca ccaggacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//