Dbfetch

ID   HM217755; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HM217755;
XX
DT   27-SEP-2010 (Rel. 106, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11:96 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2011.01650.x.
RX   PUBMED; 21395562.
RA   Lee K.W.;
RT   "Two novel HLA class II alleles, DRB1*11:96 and DQB1*02:01:03, identified
RT   in Koreans";
RL   Tissue Antigens 77(6):601-602(2011).
XX
RN   [2]
RP   1-270
RA   Lee K.W.;
RT   ;
RL   Submitted (11-MAY-2010) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; 110f3e8076456846b8672607640b45c4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11:96"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11:96"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11:96"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:E2FZH3"
FT                   /db_xref="IMGT/HLA:DRB1*11:96"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E2FZH3"
FT                   /protein_id="ADN42961.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEHWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagcactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//