spacer

EBI Dbfetch

ID   HM179543; SV 1; linear; genomic DNA; STD; HUM; 2098 BP.
XX
AC   HM179543;
XX
DT   07-SEP-2010 (Rel. 106, Created)
DT   07-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*0303 variant allele,
DE   exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2098
RA   Cho D., Kim D.-W., Kwon O.-J., Park N., Shin M.-G.;
RT   "A novel HLA-Cw*0303 variant identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-2098
RA   Cho D., Kim D.-W., Kwon O.-J., Park N., Shin M.-G.;
RT   ;
RL   Submitted (03-MAY-2010) to the INSDC.
RL   Laboratory Medicine, Chonnam National University Hwasun Hospital, 160
RL   Ilsimri, Hwasun-eup, Hwesun-gun, Jeollanam-do 519-809, Korea
XX
DR   MD5; 4f8ed24506adf2cb6ebe01a06d6b1ff2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2098
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: Cw_5'UTR_F, rev_name:
FT                   Cw_int_5R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2098
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT   mRNA            join(<1..73,204..473,719..994,1582..1857,1979..>2098)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,719..994,1582..1857,1979..>2098)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT                   /product="MHC class I antigen"
FT                   /note="leukocyte antigen C"
FT                   /db_xref="GOA:E0Z0E3"
FT                   /db_xref="IMGT/HLA:C*03:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E0Z0E3"
FT                   /protein_id="ADM47607.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEARSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSS"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT                   /number=2
FT   exon            719..994
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT                   /number=3
FT   exon            1582..1857
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT                   /number=4
FT   exon            1979..>2098
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0303 variant"
FT                   /number=5
XX
SQ   Sequence 2098 BP; 385 A; 628 C; 702 G; 383 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggttggg agggaatcgg cctctgcgga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgctgtgtc       240
     ccggcccggc cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccagtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcctcatccc ccacggacgg cccgggtcgc       540
     cccaagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcgggggc ggggccaggg       720
     tctcacatca tccagaggat gtatggctgc gacgtggggc ccgacgggcg cctcctccgc       780
     gggtatgacc agtacgccta cgacggcaag gattacatcg ccctgaacga ggatctgcgc       840
     tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt       900
     gaggcggagc agcggagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac       960
     ctgaagaatg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1020
     ccatctcctg tagatctccc gggatggcct cccacgagga ggggaggaaa atgggatcag      1080
     cgctagaata tcgccctccc ttgaatggag aatgggatga gttttcctga gtttcctctg      1140
     agggccccct ctgctctcta ggacaattaa gggatgaagt ccttgaggaa atggagggga      1200
     agacagtccc tagaatactg atcaggggtc ccctttgacc actttgacca ctgcagcagc      1260
     tgtggtcagg ctgctgacct ttctctcagg ccttgttctc tgcctcacgc tcaatgtgtt      1320
     tgaaggtttg attccagctt ttctgagtcc ttcggcctcc actcaggtca ggaccagaag      1380
     tcgctgttcc tccctcagag actagaactt tccaatgaat aggagattat cccaggtgcc      1440
     tgtgtccagg ctggcgtctg ggttctgtgc ccccttcccc accccaggtg tcctgtccgt      1500
     tctcaggatg gtcacatggg cgctgttgga gtgtcgcaag agagatacaa agtgtctgaa      1560
     ttttctgact cttcccgtca gaacacccaa agacacacgt gacccaccat cccgtctctg      1620
     accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga      1680
     cctggcagtg ggatggggag gaccaaactc aggacactga gcttgtggag accaggccag      1740
     caggagatgg aaccttccag aagtgggcag ctgtggtggt gccttctgga gaagagcaga      1800
     gatacacgtg ccatgtgcag cacgaggggc tgccggagcc cctcaccctg agatggggta      1860
     aggaggggga tgaggggtga tgtgtcttct cagggaaagc agaagtcctg gagcccttca      1920
     gccaggtcag ggctgaggct tgggggtcag ggcccctcac cttcccctcc tttcccagag      1980
     ccgtcttccc agcccaccat ccccatcgtg ggcatcgttg ctggcctggc tgtcctggct      2040
     gtcctagctg tcctaggagc tgtggtggct gttgtgatgt gtaggaggaa gagctcag        2098
//


spacer
spacer