Dbfetch

ID   HM153754; SV 1; linear; genomic DNA; STD; HUM; 2081 BP.
XX
AC   HM153754;
XX
DT   02-AUG-2010 (Rel. 105, Created)
DT   02-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*31 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2081
RA   Park N.-R., Jun J.-H., Oh H.-B., Kwon O.-J.;
RT   "New HLA-A*31 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2081
RA   Park N.-R., Jun J.-H., Oh H.-B., Kwon O.-J.;
RT   ;
RL   Submitted (26-APR-2010) to the INSDC.
RL   Molecular Genetics, Biowithus, Inc./Konkuk University, #508, Woolim e-BIZ
RL   Center, 280-21, Seongsu-dong 2-ga, Seongdong-gu, Seoul 133-120, Republic of
RL   Korea
XX
DR   MD5; 0b884cedff78e256c5a0170b13e1f4a9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2081
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2081
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant"
FT   mRNA            join(<1..73,203..472,714..989,1590..1865,1965..>2081)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,714..989,1590..1865,1965..>2081)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E2FIL8"
FT                   /db_xref="IMGT/HLA:A*31:34"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E2FIL8"
FT                   /protein_id="ADK73499.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVQWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSS"
XX
SQ   Sequence 2081 BP; 387 A; 637 C; 669 G; 388 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcgtg gggaaaccgc ctctgcgggg agaagcaagg       120
     ggcccgcccg gcgggggcgc aggacccggg tagccgcgcc gggaggaggg tcgggcggat       180
     ctcagccact cctcgccccc aggctcccac tccatgaggt atttcaccac atccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc       300
     gtgcggttcg acagcgacgc cgcgagccag aggatggagc cgcgggcgcc gtggatagag       360
     caggagaggc ctgagtattg ggaccaggag acacggaatg tgaaggccca ctcacagatt       420
     gaccgagtgg acctggggac cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccagcccg gggcgcaggt cacgacctct catcccccac ggacgggcca ggtcacccac       540
     agtctccggg tccgagatcc accccgaagc cgcgggaccc cgagaccctt gccccgggag       600
     aggcccaggc gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg       660
     gtcggggccg gacggggctc gggggactgg gctgaccgtg gggtcggggc caggttctca       720
     caccatccag atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta       780
     ccagcaggac gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg       840
     gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc       900
     ggagcagttg agagcctacc tggagggcac gtgcgtgcag tggctccgca gatacctgga       960
     gaacgggaag gagacgctgc agcgcacggg taccaggggc cacggggcgc ctccctgatc      1020
     gcctgtagat ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta      1080
     gaatatcacc ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt      1140
     accagagagt gactctgagg ttccgccctg ctctgtgaca caattaaggg ataaaatctc      1200
     tgaaggaatg acgggaagac gatccctcga atactgatga gtggttccct ttgacacaca      1260
     ccggcagcag ccttgggccc gtgacttttc ctctcaggcc ttgttctctg cttcacactc      1320
     aatgtgtgtg ggggtctgag tccagcactt ctgagtccct cagcctccac tcaggtcagg      1380
     accagaagtc gctgttccct cttcagggac tagaattttc cacggaatag gagattatcc      1440
     caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc ccttccccat cccaggtgtc      1500
     ctgtccattc tcaagatagc cacatgtgtg ctggaggagt gtcccattac agatgcaaaa      1560
     tgcctgaatg ttctgactct tcctgacaga cccccccaag acgcatatga ctcaccacgc      1620
     tgtctctgac catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat      1680
     cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac      1740
     caggcctgca ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca      1800
     ggagcagaga tacacctgcc atgtgcagca tgagggtctc cccaagcccc tcaccctgag      1860
     atggggtaag gagggagatg ggggtgtcat gtcttttagg gaaagcagga gcctctctga      1920
     cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagccgt cttcccagcc      1980
     caccatcccc atcgtgggca tcattgctgg cctagttctc tttggagctg tgttcgctgg      2040
     agctgtggtc gctgctgtga ggtggaggag gaagagctca g                          2081
//