Dbfetch

ID   HM140626; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HM140626;
XX
DT   27-AUG-2010 (Rel. 105, Created)
DT   27-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*13 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Park N.-R., Jun J.-H., Oh H.-B., Kwon O.-J.;
RT   "New HLA-DRB1*13 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Park N.-R., Jun J.-H., Oh H.-B., Kwon O.-J.;
RT   ;
RL   Submitted (20-APR-2010) to the INSDC.
RL   Molecular Genetics, Biowithus, #508, Woolim e-BIZ Center, 280-21,
RL   Seongsu-dong 2-ga, Seongdong-gu, Seoul 133-120, Republic of Korea
XX
DR   MD5; bc75d1634b49efa0c9f8b8522d8e29ac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:E0YNM2"
FT                   /db_xref="IMGT/HLA:DRB1*13:99"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E0YNM2"
FT                   /protein_id="ADM16683.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   KELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 64 C; 97 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgaag gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//