spacer

EBI Dbfetch

ID   HM140625; SV 1; linear; genomic DNA; STD; HUM; 2051 BP.
XX
AC   HM140625;
XX
DT   27-AUG-2010 (Rel. 105, Created)
DT   27-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I anitgen (HLA-B) gene, HLA-B*39 variant allele,
DE   exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2051
RA   Park N.-R., Jun J.-H., Oh H.-B., Kwon O.-J.;
RT   "New HLA-B*39 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2051
RA   Park N.-R., Jun J.-H., Oh H.-B., Kwon O.-J.;
RT   ;
RL   Submitted (20-APR-2010) to the INSDC.
RL   Molecular Genetics, Biowithus, #508, Woolim e-BIZ Center, 280-21,
RL   Seongsu-dong 2-ga, Seongdong-gu, Seoul 133-120, Republic of Korea
XX
DR   MD5; 68a1a4ade8376618fc85257a660acc14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2051
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2051
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT   mRNA            join(<1..73,202..471,718..993,1566..1841,1935..>2051)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /product="MHC class I anitgen"
FT   CDS             join(1..73,202..471,718..993,1566..1841,1935..>2051)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /product="MHC class I anitgen"
FT                   /db_xref="GOA:E0YNM1"
FT                   /db_xref="IMGT/HLA:B*39:60"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E0YNM1"
FT                   /protein_id="ADM16682.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARAAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=1
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=2
FT   exon            718..993
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=3
FT   exon            1566..1841
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=4
FT   exon            1935..>2051
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39 variant"
FT                   /number=5
XX
SQ   Sequence 2051 BP; 387 A; 634 C; 664 G; 366 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttctacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggaatattgg gaccggaaca cacagatctg caagaccaac acacagactg       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gttcgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     cggcggagca gctgagaacc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc caacgagaag aagaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     atgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc tctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag attatcccag gtgcctgcgt ccaggctggt      1440
     gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt ccattctcag gctggtcaca      1500
     tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc tgaattttct gactcttccc      1560
     atcagacccc ccaaagacac atgtgaccca ccaccccatc tctgaccatg aggccaccct      1620
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1680
     cgaggaccaa actcaggaca ccgagcttgt ggagaccaga ccagcaggag acagaacctt      1740
     ccagaagtgg gcagctgtgg tggtgccttc tggagaagag cagagataca catgccatgt      1800
     acagcatgag gggctgccga agcccctcac cctgagatgg ggtaaggagg gggatgaggg      1860
     gtcatatctc ttctcaggga aagcaggagc ccttcagcag ggtcagggcc cctcatcttc      1920
     ccctcctttc ccagagccat cttcccagtc caccgtcccc atcgtgggca ttgttgctgg      1980
     cctggctgtc ctagcagttg tggtcatcgg agctgtggtc gctgctgtga tgtgtaggag      2040
     gaagagttca g                                                           2051
//


spacer
spacer