spacer

EBI Dbfetch

ID   HM135954; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HM135954;
XX
DT   02-JUN-2010 (Rel. 105, Created)
DT   02-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*05 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Oh H.-B., Kwon O.-J., Park N.R.;
RT   ;
RL   Submitted (02-APR-2010) to the INSDC.
RL   Laboratory Medicine, Asan Medical Center, 86, Asanbyeoung-gil, Songpa-gu,
RL   Seoul 138-736, South Korea
XX
DR   MD5; 4813da876a68d9b8a17eb87dc92d7f56.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D7RVC1"
FT                   /db_xref="IMGT/HLA:DQB1*05:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D7RVC1"
FT                   /protein_id="ADH82122.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRLDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 64 C; 106 G; 42 T; 0 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggagtacgt gcgcttggac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagagt gtgcagacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag                                        270
//


spacer
spacer