Dbfetch

ID   HM125713; SV 2; linear; genomic DNA; STD; HUM; 1025 BP.
XX
AC   HM125713;
XX
DT   15-JUN-2010 (Rel. 105, Created)
DT   27-APR-2012 (Rel. 112, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*66 novel allele, exons
DE   2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1025
RX   DOI; 10.1111/j.1399-0039.2011.01816.x.
RX   PUBMED; 22187966.
RA   Wowk P.F., Mattar S.B., Rodrigues F., da Graca Bicalho M.;
RT   "A novel allele, HLA-A*66:14, identified in a Brazilian volunteer bone
RT   marrow donor";
RL   Tissue Antigens 79(3):207-208(2012).
XX
RN   [2]
RP   1-1025
RA   Bicalho M.G., Mattar S.B., Wowk P.F.;
RT   ;
RL   Submitted (15-APR-2010) to the INSDC.
RL   Departamento de Genetica, Universidade Federal Do Parana, Rua Francisco H
RL   Dos Santos, S/N, Curitiba, Parana 81530-980, Brasil
XX
DR   MD5; c1605a638094564424cc728642f73152.
XX
CC   On Jun 17, 2010 this sequence version replaced gi:298106283.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1025
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1025
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 novel"
FT   mRNA            join(<1..271,372..647,748..>1025)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 novel"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..271,372..647,748..>1025)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*66:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:D7RTU8"
FT                   /protein_id="ADI56258.2"
FT                   /translation="GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM
FT                   EPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQRMYGCDVG
FT                   PDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGR
FT                   CVEWLRRYLENGKETLQRADAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGE
FT                   DQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWE"
FT   exon            1..271
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 novel"
FT                   /number=2
FT   gap             272..371
FT                   /estimated_length=unknown
FT   exon            372..647
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 novel"
FT                   /number=3
FT   gap             648..747
FT                   /estimated_length=unknown
FT   exon            748..1025
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66 novel"
FT                   /number=4
XX
SQ   Sequence 1025 BP; 166 A; 247 C; 292 G; 120 T; 200 other;
     ggctcccact ccatgaggta tttctacacc tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc       120
     gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg       180
     gaccggaaca cacggaatgt gaaggcccag tcacagactg accgagtgga cctggggacc       240
     ctgcgcggct actacaacca gagcgaggac gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ngttctcaca ccatccagag gatgtatggc tgcgacgtgg ggccggacgg       420
     gcgcttcctc cgcgggtacc agcaggacgc ttacgacggc aaggattaca tcgccctgaa       480
     cgaggacctg cgctcttgga ccgcggcgga catggcggct cagatcaccc agcgcaagtg       540
     ggagacggcc catgaggcgg agcagtggag agcctacctg gagggccggt gcgtggagtg       600
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgcggnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnacg cccccaagac gcatatgact caccacgctg       780
     tctctgacca tgaggccacc ctgaggtgct gggccctgag cttctaccct gcggagatca       840
     cactgacctg gcagcgggat ggggaggacc agacccagga cacggagctc gtggagacca       900
     ggcctgcagg ggatgggacc ttccagaagt gggcgtctgt ggtggtgcct tctggacagg       960
     agcagagata cacctgccat gtgcagcatg agggtctgcc caagcccctc accctgagat      1020
     gggag                                                                  1025
//