spacer

EBI Dbfetch

ID   HM122208; SV 1; linear; genomic DNA; STD; HUM; 1412 BP.
XX
AC   HM122208;
XX
DT   19-APR-2011 (Rel. 108, Created)
DT   19-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40:02:01variant3
DE   allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1412
RA   Qu J., Li J., Du J., Chen H., Liao K., Tian Z., Zhen H., Chen Y., Huang C.,
RA   Wang L., Shen M., Zhang H., Jiang F.;
RT   "Identification of 47 novel HLA-B alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1412
RA   Qu J., Li J., Du J., Chen H., Liao K., Tian Z., Zhen H., Chen Y., Huang C.,
RA   Wang L., Shen M., Zhang H., Jiang F.;
RT   ;
RL   Submitted (14-APR-2010) to the INSDC.
RL   Beijing Genomics Institute, Shenzhen, Beishan Industrial Zone, Yantian
RL   District, Shenzhen, Guangdong 518083, China
XX
DR   MD5; 9a01d7a6e2d2e3a3a48c6b126ca0f517.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1412
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1412
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen"
FT                   /db_xref="GOA:F4YTF5"
FT                   /db_xref="IMGT/HLA:B*40:143"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F4YTF5"
FT                   /protein_id="AEB66088.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMFGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..>1412
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01variant3"
FT                   /number=5
XX
SQ   Sequence 1412 BP; 203 A; 316 C; 337 G; 156 T; 400 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttccaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     caccgtgggc tacgtggacg acacgctgtt cgtgaggttc gacagcgacg ccacgagtcc       300
     gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagatc tccaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag agcatgttcg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagtac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagt ccaccgtccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctgctgtg atgtgtagga ggaagagctc ag                                    1412
//


spacer
spacer