spacer

EBI Dbfetch

ID   HM068863; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   HM068863;
XX
DT   13-MAY-2010 (Rel. 104, Created)
DT   13-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2601novel allele, exon
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Gao S., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Zhang K.,
RA   Zhao B., Gong Z., Jia Y., Wang D., Cui S., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Gao S., Shan X., He X., Liu N., Wang L., Li W., Wang L., Ni L., Zhang K.,
RA   Zhao B., Gong Z., Jia Y., Wang D., Cui S., Zhang Z.;
RT   ;
RL   Submitted (22-MAR-2010) to the INSDC.
RL   HLA Lab, Bejing Red Cross Blood Center, No. 37 Beisanhuan Zhong Road,
RL   Beijing 100088, China
XX
DR   MD5; b4db7dc0f02825aad14117a24a4e285f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601novel"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601novel"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D6R3X5"
FT                   /db_xref="IMGT/HLA:A*26:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D6R3X5"
FT                   /protein_id="ADG34823.1"
FT                   /translation="SHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAA
FT                   DMAAHITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601novel"
FT                   /number=3
FT   variation       152
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="results in histidine to glutamine substitution"
XX
SQ   Sequence 276 BP; 56 A; 80 C; 102 G; 38 T; 0 other;
     gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg cgcttcctcc        60
     gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc acatcaccca gcgcaagtgg gagacggccc       180
     atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer