spacer

EBI Dbfetch

ID   HM067857; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   HM067857;
XX
DT   16-JUN-2010 (Rel. 105, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*13:12 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RX   DOI; 10.1111/j.1399-0039.2010.01626.x.
RX   PUBMED; 21388356.
RA   Zhu F., He Y., Tao S., Zhang W., He J., He J., Xu X., Lv H., Yan L.;
RT   "Analysis of the complete cDNA sequences of HLA-DRB1 alleles with
RT   group-specific amplification primers in the Chinese Han population";
RL   Tissue Antigens 77(4):329-332(2011).
XX
RN   [2]
RP   1-801
RA   Zhu F.M., He Y.M., Yan L.X.;
RT   "Full length cDNA sequence of HLA-DRB1*13:12";
RL   Unpublished.
XX
RN   [3]
RP   1-801
RA   Zhu F.M., He Y.M., Yan L.X.;
RT   ;
RL   Submitted (07-APR-2010) to the INSDC.
RL   HLA Typing Laboratory, Transfusion Research Institute, Wulin Road 345,
RL   Hangzhou, Zhejiang 310006, China
XX
DR   MD5; eb772842f6786bad7c33c434e4a94b97.
DR   H-InvDB; HIT000649160_03.2.
DR   H-InvDB; HIT000649160_04.2.
DR   H-InvDB; HIT000649160_05.2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13:12"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13:12"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D7RIH4"
FT                   /db_xref="H-InvDB:HIT000649160_01.2"
FT                   /db_xref="IMGT/HLA:DRB1*13:12:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D7RIH4"
FT                   /protein_id="ADI59569.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDILEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
XX
SQ   Sequence 801 BP; 173 A; 202 C; 257 G; 169 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagtactct       120
     acgtctgagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tataaccaag aggagtacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctagcgc cgagtactgg aacagccaga aggacatcct ggaagacagg       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaagaggat tcctgagctg a                                                 801
//


spacer
spacer