Dbfetch

ID   HM067847; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   HM067847;
XX
DT   16-JUN-2010 (Rel. 105, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*04:06:01
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RX   DOI; 10.1111/j.1399-0039.2010.01626.x.
RX   PUBMED; 21388356.
RA   Zhu F., He Y., Tao S., Zhang W., He J., He J., Xu X., Lv H., Yan L.;
RT   "Analysis of the complete cDNA sequences of HLA-DRB1 alleles with
RT   group-specific amplification primers in the Chinese Han population";
RL   Tissue Antigens 77(4):329-332(2011).
XX
RN   [2]
RP   1-801
RA   Zhu F.M., He Y.M., Yan L.X.;
RT   "Full length cDNA sequence of HLA-DRB1*04:06:01";
RL   Unpublished.
XX
RN   [3]
RP   1-801
RA   Zhu F.M., He Y.M., Yan L.X.;
RT   ;
RL   Submitted (07-APR-2010) to the INSDC.
RL   HLA Typing Laboratory, Transfusion Research Institute, Wulin Road 345,
RL   Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 2ebf0523959c223e0a04026b2cfc3cd7.
DR   H-InvDB; HIT000649150_03.2.
DR   H-InvDB; HIT000649150_04.2.
DR   H-InvDB; HIT000649150_05.2.
DR   H-InvDB; HIT000649150_06.2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04:06:01"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04:06:01"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q56FN8"
FT                   /db_xref="H-InvDB:HIT000649150_01.2"
FT                   /db_xref="IMGT/HLA:DRB1*04:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:Q56FN8"
FT                   /protein_id="ADI59559.1"
FT                   /translation="MVCLKFPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKHECH
FT                   FFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAEV
FT                   DTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 801 BP; 172 A; 206 C; 259 G; 164 T; 0 other;
     atggtgtgtc tgaagttccc tggaggctcc tgcatggcag ctctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacacccgac cacgtttctt ggagcaggtt       120
     aaacatgagt gtcatttctt caacgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tatcaccaag aggagtccgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctgatgc cgagtactgg aacagccaga aggacctcct ggagcagagg       300
     cgggccgagg tggacaccta ctgcagacac aactacgggg ttgtggagag cttcacagtg       360
     cagcggcgag tctatcctga ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcctgacg agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gcttcgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg a                                                 801
//