Dbfetch

ID   HM053478; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   HM053478;
XX
DT   02-JUN-2010 (Rel. 105, Created)
DT   02-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*04 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   He J., Yuan X., Bao X., Li Y., Qiu Q., Xu C.;
RT   ;
RL   Submitted (01-APR-2010) to the INSDC.
RL   HLA Lab, The First Affiliated Hospital of Soochow University, 188 Shizi
RL   Street, Suzhou, Jangsu 215006, P.R. China
XX
DR   MD5; bed1651ced5e02dacbf844ae81bafb87.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>267
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04 new"
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D7REY6"
FT                   /db_xref="IMGT/HLA:DQB1*04:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D7REY6"
FT                   /protein_id="ADH43283.1"
FT                   /translation="DFVYQFKGMCYFTNGTELVRGVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQR"
FT   exon            1..>267
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04 new"
FT                   /number=2
XX
SQ   Sequence 267 BP; 58 A; 69 C; 93 G; 47 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacc gagctcgtgc        60
     ggggtgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc ggcttgacgc cgagtactgg aatagccaga       180
     aggacatcct ggaggaggac cgggcgtcgg tggacaccgt atgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggc                                           267
//