spacer

EBI Dbfetch

ID   HM051203; SV 1; linear; genomic DNA; STD; HUM; 1254 BP.
XX
AC   HM051203;
XX
DT   06-JUN-2010 (Rel. 105, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I polypeptide-related sequence A precursor (MICA)
DE   gene, MICA*01201 variant allele, exons 2 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1254
RX   DOI; 10.1016/j.humimm.2011.08.021.
RX   PUBMED; 22100839.
RA   Xu X., Xia W., Tian L., Chen Y., Ding H., Shao Y., Deng J., Wang J.,
RA   Huang Y., Santoso S., Fu Y., Ye X.;
RT   "Distribution of MICA haplotypes in a Chinese Han population";
RL   Hum. Immunol. 73(1):75-79(2012).
XX
RN   [2]
RP   1-1254
RA   Ye X., Fu Y.S., Xu X.Z., Ding H.Q., Ji Y.L., Zou Y.Z., Stastny P.,
RA   Xia W.J., Rong X., Luo G.P., Shao Y.A.;
RT   ;
RL   Submitted (31-MAR-2010) to the INSDC.
RL   Institute of Transfusion, Guangzhou Blood Center, 31 Luyuan Road,
RL   Guangzhou, Guangdong 510095, China
XX
DR   MD5; 55b272c9f4b18fbad6fd4213c60e8450.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1254
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: MICA6823-1F, rev_name:
FT                   MICA9023-4R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1254
FT                   /gene="MICA"
FT                   /allele="MICA*01201 variant"
FT   mRNA            join(<1..255,356..643,744..1022,1123..>1254)
FT                   /gene="MICA"
FT                   /allele="MICA*01201 variant"
FT                   /product="MHC class I polypeptide-related sequence A
FT                   precursor"
FT   CDS             join(<1..255,356..643,744..1022,1123..>1254)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*01201 variant"
FT                   /product="MHC class I polypeptide-related sequence A
FT                   precursor"
FT                   /db_xref="GOA:D7REL5"
FT                   /db_xref="IMGT/HLA:MICA*061"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7REL5"
FT                   /protein_id="ADI24780.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTLYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGKEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   exon            <1..255
FT                   /gene="MICA"
FT                   /allele="MICA*01201 variant"
FT                   /number=2
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="MICA*01201 variant"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="MICA*01201 variant"
FT                   /number=4
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..>1254
FT                   /gene="MICA"
FT                   /allele="MICA*01201 variant"
FT                   /number=5
XX
SQ   Sequence 1254 BP; 244 A; 241 C; 264 G; 205 T; 300 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttctcac tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag agacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acaatgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacactctat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctaaaatc cggcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac attaccgtga catgcagggc ttctggcttc tatccctgga atatcacact       840
     gagctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggaaagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctatt tttgttatta      1200
     ttattttcta tgtccgttgt tgtaagaaga aaacatcagc tgcagagggt ccag            1254
//


spacer
spacer