Dbfetch

ID   HM045286; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   HM045286;
XX
DT   26-MAY-2010 (Rel. 104, Created)
DT   26-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*0227var allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Recker K., Fuerst D., Mytilineos J.;
RT   "A new variant of HLA-Cw*0227";
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Recker K., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (31-MAR-2010) to the INSDC.
RL   Transplant Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081, Germany
XX
DR   MD5; 49af43654d1d3890b11fc638cd3017e7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>546
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0227var"
FT   mRNA            <1..>546
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0227var"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0227var"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen"
FT                   /db_xref="IMGT/HLA:C*02:27:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:D7R8B0"
FT                   /protein_id="ADH04229.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 546 BP; 108 A; 170 C; 199 G; 69 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagtggaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//