spacer

EBI Dbfetch

ID   HM019306; SV 1; linear; genomic DNA; STD; HUM; 1683 BP.
XX
AC   HM019306;
XX
DT   03-MAY-2010 (Rel. 104, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*NEW-SY
DE   allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1683
RX   DOI; 10.1016/j.humimm.2011.03.006.
RX   PUBMED; 21513756.
RA   Tian W., Cai J., Liu X.;
RT   "MICA genetic polymorphism and HLA-A,C,B,MICA and DRB1 haplotypic variation
RT   in a southern Chinese Han population: identification of two new MICA
RT   alleles, MICA*060 and MICA*062";
RL   Hum. Immunol. 72(6):510-515(2011).
XX
RN   [2]
RP   1-1683
RA   Tian W., Cai J.H., Liu X.X.;
RT   "A new MICA allele differing from MICA*010 in exon 4 in a southern Chinese
RT   Han population";
RL   Unpublished.
XX
RN   [3]
RP   1-1683
RA   Tian W., Cai J.H., Liu X.X.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Immunogenetics Research Group, Central South University School of Medicine,
RL   Tongzipo Road 173#, Changsha, Hunan 410013, China
XX
DR   MD5; 41e978b5460602cfecbeb51b7d0d46db.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1683
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: cagacttgcaggtcaggggtcccg, rev_seq:
FT                   caatgactctgaagcaccagcact"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1683
FT                   /gene="MICA"
FT                   /allele="MICA*NEW-SY"
FT   mRNA            join(<1..255,530..817,1405..>1683)
FT                   /gene="MICA"
FT                   /allele="MICA*NEW-SY"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,530..817,1405..>1683)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*NEW-SY"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:D6QZ32"
FT                   /db_xref="IMGT/HLA:MICA*062"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D6QZ32"
FT                   /protein_id="ADF58430.1"
FT                   /translation="PHSLPYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSRNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*NEW-SY"
FT                   /number=2
FT   gap             256..529
FT                   /estimated_length=274
FT   exon            530..817
FT                   /gene="MICA"
FT                   /allele="MICA*NEW-SY"
FT                   /number=3
FT   gap             818..1404
FT                   /estimated_length=587
FT   exon            1405..1683
FT                   /gene="MICA"
FT                   /allele="MICA*NEW-SY"
FT                   /number=4
FT   variation       1653
FT                   /gene="MICA"
FT                   /replace="g"
FT                   /note="as compared to MICA*010"
XX
SQ   Sequence 1683 BP; 215 A; 221 C; 231 G; 155 T; 861 other;
     agccccacag tcttccttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacagtg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctag aatccagcgt agtcctgagg agaacagnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnntgcccc ccatggtgaa tgtcacccgc agcgaggcct      1440
     cagagggcaa catcaccgtg acatgcaggg cttccagctt ctatccccgg aatatcatac      1500
     tgacctggcg tcaggatggg gtatctttga gccacgacac ccagcagtgg ggggatgtcc      1560
     tgcctgatgg gaatggaacc taccagacct gggtggccac caggatttgc cgaggagagg      1620
     agcagaggtt cacctgctac atggaacaca gcaggaatca cagcactcac cctgtgccct      1680
     ctg                                                                    1683
//


spacer
spacer