Dbfetch

ID   HM008266; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HM008266;
XX
DT   05-APR-2011 (Rel. 108, Created)
DT   05-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0405variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Ji Y., Xie J., Sun Y.;
RT   "A novel allele in Chinese individual";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Ji Y., Sun Y., Xie J., Tang Q., Zheng J., Mao Z., Liu Y., Yang J., Du K.;
RT   ;
RL   Submitted (16-MAR-2010) to the INSDC.
RL   Immunogenetics Lab, Shanghai Blood Center, No. 1191 Hongqiao Rd, Shanghai,
RL   Shanghai 200051, China
XX
DR   MD5; 5a8395f0a46ef82e252b0fad4267564e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0405variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0405variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0405variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F2VS07"
FT                   /db_xref="IMGT/HLA:DRB1*04:90"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F2VS07"
FT                   /protein_id="AEA51191.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDLLEQRRAAVDTVCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 65 C; 100 G; 47 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//