spacer

EBI Dbfetch

ID   HM003645; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HM003645;
XX
DT   05-APR-2011 (Rel. 108, Created)
DT   05-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1501variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Ji Y., Sun Y., Xie J., Zhen J., Tang Q., Mao Z., Liu Y., Yang J., Du K.;
RT   "A novel allele in Chinese individual";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Ji Y., Xie J., Sun Y., Zhen J., Tang Q., Liu Y., Yang J., Mao Z., Du K.;
RT   ;
RL   Submitted (15-MAR-2010) to the INSDC.
RL   Immunogenetics Lab, Shanghai Blood Center, No. 1191 Hongqiao Rd, Shanghai,
RL   Shanghai 200051, China
XX
DR   MD5; d2da757b963afe64a3bacd2f122a91d1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F2VS02"
FT                   /db_xref="IMGT/HLA:DRB1*15:02:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F2VS02"
FT                   /protein_id="AEA51189.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 55 A; 65 C; 101 G; 49 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgatgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer