Dbfetch

ID   HG970095; SV 1; linear; genomic DNA; STD; HUM; 3388 BP.
XX
AC   HG970095;
XX
DT   09-APR-2014 (Rel. 120, Created)
DT   09-APR-2014 (Rel. 120, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*17:03
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3388
RA   McWhinnie A.J.;
RT   ;
RL   Submitted (13-MAR-2014) to the INSDC.
RL   McWhinnie A.J., HLA Group, ANTHONY NOLAN RESEARCH INSTITUTE, Fleet Road,
RL   Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   McWhinnie A.J., Robinson J.;
RT   "Confirmatory sequencing of HLA-C*17:03";
RL   Unpublished.
XX
DR   MD5; 3c1479a6a7031f41ee7c5359e368c8ab.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3388
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="ANmulti027"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(303..375,506..775,1022..1297,1885..2160,2285..2422,
FT                   2861..2893,3001..3048,3213..3217)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I2G9F9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:I2G9F9"
FT                   /protein_id="CDO58212.1"
FT                   /translation="MRVMAPQALLLLLSGALALIETWTGSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAVLAVLAVLAVLGAVVAAVIHR
FT                   RKSSGGKGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            303..375
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=1
FT   intron          376..505
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=1
FT   exon            506..775
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=2
FT   intron          776..1021
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=2
FT   exon            1022..1297
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=3
FT   intron          1298..1884
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=3
FT   exon            1885..2160
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=4
FT   intron          2161..2284
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=4
FT   exon            2285..2422
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=5
FT   intron          2423..2860
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=5
FT   exon            2861..2893
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=6
FT   intron          2894..3000
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=6
FT   exon            3001..3048
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=7
FT   intron          3049..3212
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=7
FT   exon            3213..3217
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*17:03"
FT                   /number=8
XX
SQ   Sequence 3388 BP; 628 A; 992 C; 1058 G; 710 T; 0 other;
     gcttggtgta ggagaagagg gatcaggacg aagtcccagg tcccgggcgg ggctctctgg        60
     gtctcaagct cccagggccg tgtctgcatt ggggaggcgc agcgttgggg attccccact       120
     cccactcccc tgagtttcac ttcttctccc aacctgcgtc gggtccttct tcctgaatac       180
     tcatgacgcg tccccaattc ccactcccat tgggtgtcgg gttctagaga agccaatcag       240
     cgtctacgca gtcccggttc tgaagtcacc cacccggact cagattctcc ccagacgccg       300
     agatgcgggt catggcgccc caagccctcc tcctgctgct ctcgggagcc ctggccctga       360
     tcgagacctg gaccggtgag tgcggggttg ggagggaaac ggcctctgcg gagaggagcg       420
     aggggcccgc ccggcgaggg cgcaggaccc ggggagccgc gcagggagga gggtcgggcg       480
     ggtctcagcc cctcctcgcc cccaggctcc cactccatga ggtatttcta caccgccgtg       540
     tcccggcccg gccgcggaga gccccgcttc atcgcagtgg gctacgtgga cgacacgcag       600
     ttcgtgcggt tcgacagcga cgccgcgagt ccgagagggg agccgcgggc gccgtgggtg       660
     gagcaggagg ggccggagta ttgggaccgg gagacacaga agtacaagcg ccaggcacag       720
     gctgaccgag tgaacctgcg gaaactgcgc ggctactaca accagagcga ggccggtgag       780
     tgaccccagc ccggggcgca ggtcacgacc cctccccatc ccccacggac ggcccgggtc       840
     gccccgagtc tcccggtctg agatcctccc cgaggctgcg gaacccgccc agaccctcga       900
     ccggagagag ccctagtcgc ctttacccgg tttcattttc agtttaggcc aaaatccccg       960
     cgggttggtc ggggctgggg cggggctcgg gggacggggc tgaccacggg ggcggggcca      1020
     ggttctcaca ccatccagag gatgtatggc tgcgacctgg ggcccgacgg gcgcctcctc      1080
     cgcgggtata accagttcgc ctacgacggc aaggattaca tcgccctgaa cgaggacctg      1140
     cgctcctgga ccgcggcgga cacggcggct cagatctccc agcgcaagtt ggaggcggcc      1200
     cgtgaggcgg agcagctgag agcctacctg gagggcgagt gcgtggagtg gctccgcgga      1260
     tacctggaga acgggaagga gacgctgcag cgcgcgggta ccaggggcag tggggagcct      1320
     tccccatctc ctatagatct cccgggatgg cctcccacga ggaggggagg aaaatgggat      1380
     cagcgctaga atatcgccct cccttgaatg gagaatggga tgagttttcc cgagtttcct      1440
     ctgagggccc cgtctgctct ctaggacaat taagggatga agtccctgag gaaatggagg      1500
     ggaagacagt ccctggaata ctgatcaggg gtcccctttg accactttga ccactgcggc      1560
     agctgtggtc aggctgctga cctttctctc aggccttgtt ctctgcctca cactcaatgt      1620
     gtctgaaggt ttgattccag cttttctgag tccttcggcc tccactcagg tcaggaccag      1680
     aagtcgctgt tcctccctca gagactagaa ctttccaaag aataggagat tatcccaggt      1740
     ccctgtgtcc aggctggcgt ctgggttctg tgcccccttc cctaccccag gtgtcctgtc      1800
     cattctcagg atggtcacat gggcgctgct ggagtgtcgc aagagagata caaagtgtct      1860
     gaattttctg actcttcccg tcagaacgcc caaagacaca cgtgacccac catcccgtct      1920
     ctgaccatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcacac      1980
     tgacctggca gcgggatggg gaggaccaaa ctcaggacac cgagcttgtg gagaccaggc      2040
     cagcaggaga tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggacaagaac      2100
     agagatacac gtgccatgtg cagcacgagg ggctgcagga gccctgcacc ctgagatgga      2160
     gtaaggaggg ggatgagggg tcatgtgtct tctcagggaa agcagaagtc cttctggagc      2220
     ccttcagccg ggtcagggct gaggcttggg tgtaagggcc cctcaccttc ccctcctttc      2280
     ccagagccgt cttcccagcc caccatcccc aacttgggca tcgtttctgg cccagctgtc      2340
     ctggctgtcc tggctgtcct ggctgtccta gctgtcctag gagctgtggt cgctgctgtg      2400
     atacatagga ggaagagctc aggtagggaa ggggtgagga gtggggtctg ggttttcttg      2460
     tcccactggg agtttcaagc cccaggtaga agtgtgcccc acctcgttac tggaagcacc      2520
     atccacacct gggccatccc agcctgggac cctgtgtgcc agcacttact ctgttgtgaa      2580
     gcacatgaca acgaaggaca gatgtatcac cttgatgatt atggtgttgg ggtcctgatt      2640
     ccagcattcg tgagtcaggg gaaggtccct gctaaggaca gaccttagga gggcagttgc      2700
     tccagaaccc acagctgctt tccccgtgtt tcctgatcct gccctgggtc tgcagtcata      2760
     gttctggaaa cttctcttgg gtccaagact aggaggttcc cctaagatcg catggccctg      2820
     cctcctccct gtcccctcac agggcatttt cttcccacag gtggaaaagg agggagctgc      2880
     tctcaggctg cgtgtaagtg atggcggtgg gcgtgtggag gagctcacct accccataat      2940
     tcctcttgtc ccacatctcc tgcgggctct gaccaggtct ttttttttgt tctaccccag      3000
     ccagcaacag tgcccagggc tctgatgagt ctctcatcgc ttgtaaaggt gagattctgg      3060
     ggagctgaag tggtcggggg tggggcagag ggaaaaggcc tgggtaatgg ggatcctttg      3120
     attgggacgt ttcgagtgtg tggtggactg ttcagagtgt catcacttac catgactgac      3180
     ctgaatttgt tcatgactat tgtgttctgt agcctgagac agctgcctgt gtgggactga      3240
     gatgcaggat ttcttcacac ctctcctttg tgacttcaag agcctctggc atctctttct      3300
     gcaaaggcat ctgaatgtgt ctgcgttcct gttagcataa tgtgaggagt tggagagaca      3360
     gctcaccccc gtgtccaccg tgacccct                                         3388
//