Dbfetch

ID   HG965156; SV 1; linear; genomic DNA; STD; HUM; 3374 BP.
XX
AC   HG965156;
XX
DT   26-MAR-2014 (Rel. 120, Created)
DT   26-MAR-2014 (Rel. 120, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC Class I antigen, HLA-C*07:04:02 allele,
DE   exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3374
RA   McWhinnie A.J.;
RT   ;
RL   Submitted (24-FEB-2014) to the INSDC.
RL   HLA Group, Anthony Nolan Research Institute, Fleet Road, Hampstead, London,
RL   NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   McWhinnie A.J., Robinson J.;
RT   "Sequencing of HLA-C*07:04:02.";
RL   Unpublished.
XX
DR   MD5; 655887af9b7b117c85921271bdcd8b29.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3374
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="ANmulti028"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(301..373,504..773,1024..1299,1887..2162,2287..2406,
FT                   2847..2879,2987..3034,3199..3203)
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT   CDS             join(301..373,504..773,1024..1299,1887..2162,2287..2406,
FT                   2847..2879,2987..3034,3199..3203)
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /product="MHC Class I antigen"
FT                   /function="Antigen presenting molecule"
FT                   /db_xref="GOA:Q7YQB2"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQB2"
FT                   /protein_id="CDO33944.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTFQRMYGCDLGPDGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQDRAYLEGTCVEWLRRYLENGKKTLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   exon            301..373
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=1
FT   intron          374..503
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=2
FT   intron          774..1023
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=2
FT   exon            1024..1299
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=3
FT   intron          1300..1886
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=3
FT   exon            1887..2162
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=4
FT   intron          2163..2286
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=4
FT   exon            2287..2406
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=5
FT   intron          2407..2846
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=5
FT   exon            2847..2879
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=6
FT   intron          2880..2986
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=6
FT   exon            2987..3034
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=7
FT   intron          3035..3198
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=7
FT   exon            3199..3203
FT                   /gene="HLA-C"
FT                   /allele="C*07:04:02"
FT                   /number=8
XX
SQ   Sequence 3374 BP; 627 A; 992 C; 1051 G; 704 T; 0 other;
     gcttggtgta ggagaagagg gatcaggacg aagtcccagg tcccgggcgg ggctctcagg        60
     gtctcaggct ccaagggccg tgtctgcact ggggaggcgc cgcgttgagg attctccact       120
     cccctgagtt tcacttctcc caacctgcgt cgggtccttc ttcctgaata ctcatgacgc       180
     gtccccaatt cccactccca ttgggtgtcg ggttctagag aagccaatca gcgtctccgc       240
     agtcccggtt ctaaagtccc cagtcaccca cccggactca cattctcccc agaggccgag       300
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc       360
     gagacctggg cctgtgagtg cggggttggg agggaagcgg cctctgcgga gaggagcgag       420
     gggccctccc ggcgagggcg caggacccgg ggagccgcgc agggaggtgg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttcgaca ccgccgtgtc       540
     ccggcccggc cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccccgggcgc cgtgggtgga       660
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       720
     tgaccgagtg agcctgcgga acctgcgcgg ctactataac cagagcgagg acggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       840
     cccgagtctc cccgtctgag atccacccca aggtggatct gcggaacccg cccagaccct       900
     cgaccggaga gagccccagt cgcctttacc cggtttcatt ttcggtttag gccaaaatcc       960
     ccgcgggttg gtcggggcgg ggcggggctc gggggactgg gctgaccgcg ggggcggggc      1020
     cagggtctca caccttccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc      1080
     tccgcgggta tgaccagttc gcctacgacg gcaaggatta catcgccctg aacgaggacc      1140
     tgcgctcctg gaccgccgcg gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg      1200
     cccgtgcggc ggagcaggac agagcctacc tggagggcac gtgcgtggag tggctccgca      1260
     gatacctgga gaacgggaag aagacgctgc agcgcgcggg taccaggggc agtggggagc      1320
     cttccccatc tcctatagat ctcccgggat ggcctcccac gaggagggga ggaaaatggg      1380
     atcagcactg gaatatcgcc ctcccttgaa tggagaatgg catgagtttt cctgagtttc      1440
     ctctgagggc cccctctgct ctctaggaca attaagggat gaagtctctg aggaaatgga      1500
     ggggaagaca gtccctggaa tactgatcag gggtctcctt tgaccacttt gaccactgca      1560
     gcagctgtgg tcaggctgct gacctttctc tcaggccttg ttctctgcct cacactcaat      1620
     gtgtctgaag gtttgattcc agcttttctg agtcctgcag cctccactca ggtcaggacc      1680
     agaagtcgct gttcctccct cagagactag aactttccaa tgaataggag attatcccag      1740
     gtgcctgtgt ccaggctggc gtctgggttc tgtgccgcct tccccacccc aggtgtcctg      1800
     tccattctca ggatggtcac atgggcgctg ctggagtgtc ccaagagaga tgcaaagtgt      1860
     ctgaattttc tgactcttcc cgtcagaacc cccaaagaca cacgtgaccc accaccccct      1920
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1980
     actgacctgg cagcgggatg gggaggacca gacccaggac accgagcttg tggagaccag      2040
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga      2100
     gcagagatac acgtgccata tgcagcacga ggggctgcaa gagcccctca ccctgagctg      2160
     gggtaaggag gggaatgggg ggtcacatct cttatcagag aaagcagaag tccttctgga      2220
     gcccttcagc cgggtcaggg ctgaggcttg ggggtcaggg cccctcacct tctcctcctt      2280
     tcccagagcc atcttcccag cccaccatcc ccatcatggg catcgttgct ggcctggctg      2340
     tcctggttgt cctagctgtc cttggagctg tggtcaccgc tatgatgtgt aggaggaaga      2400
     gctcaggtag ggaaggggtg aagagcgggg tctgggtttt cttgtcccac tgggagtttc      2460
     aagccccagg tagaagtgtg ccccgccttg ttactggaag caccatccac acatgggcca      2520
     tcccagcctg ggaccctgtg tgccagcact tactcttttg tgaagcacat gtgacaatga      2580
     aggacggatg tatcaccttg atgattatgg tgttggggtc ctgattccag cattcatgag      2640
     tcaggggaag gtccctgcta aggacagacc ttaggagggc agttggtcca gaacccacag      2700
     ctgctttccc catgtttcct gatcctgccc tgggtctgca gtcgtagttc tggaaacttc      2760
     tcttgggtcc aagactagga ggttccccta agatcacatg gccctgcctc ctcccagtcc      2820
     cctcataggg cattttcttc ccacaggtgg aaaaggaggg agctgctctc aggctgcgtg      2880
     taagtgatgg cggcgggcgt gtggaggagc tcacctactc cataattcct cttgtcccac      2940
     atctcctgcg ggctctgacc aggtcttttt ttttgttcta ccccaggcag caacagtgcc      3000
     cagggctctg atgagtctct catcacttgt aaaggtgaga ttctggggag ctgaagtggt      3060
     cgggggtggg gcagagggaa aaggcctggg taatggggat tctttgattg ggacgtttcg      3120
     agtgtgtggt gggccgttca gagtgtcatc acttaccatg actgacctga atttgttcat      3180
     gactattgtg ttctgtagcc tgagacagct gcctgtgtgg gactgagatg caggatttct      3240
     tcacacctct cctttgtgac ttcaagagcc tctggcatct ctttctgcaa aggcatctga      3300
     atgtgtctgc gttcctgtta gcataatgtg aggaggtgga gagacagccc acccccgtgt      3360
     ccaccgtgac ccct                                                        3374
//