spacer

EBI Dbfetch

ID   HF562215; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   HF562215;
XX
DT   20-JAN-2013 (Rel. 115, Created)
DT   20-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA-DPB1*09:01v, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Bengtsson M.;
RT   ;
RL   Submitted (20-NOV-2012) to the INSDC.
RL   Rudbeck Laboratory, University Hospital, Dept of Immunology, Genetics and
RL   Patholo, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Knutsson C., Bengtsson M.;
RT   "A new HLA DPB1*09:01 variant";
RL   Unpublished.
XX
DR   MD5; 640b9aa9eb5a5ade0e48865f665533e6.
DR   IMGT/HLA; DPB1*09:01:02; HLA09088.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*09:01v"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:L8BT22"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:L8BT22"
FT                   /protein_id="CCP01066.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEERAVPDRVCRHNYELDEAVTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*09:01v"
FT                   /number=2
XX
SQ   Sequence 264 BP; 64 A; 64 C; 96 G; 40 T; 0 other;
     agaattacgt gcaccagtta cggcaggaat gctacgcgtt taatgggaca caacgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggacta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca gggtatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgag                                              264
//


spacer
spacer