spacer

EBI Dbfetch

ID   HF549029; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HF549029;
XX
DT   07-JAN-2013 (Rel. 115, Created)
DT   07-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*01, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   GAGNE K.;
RT   ;
RL   Submitted (02-NOV-2012) to the INSDC.
RL   EFS Pays de la Loire, Laboratoire HLA, 34 bd Jean Monnet, F-44011 Nantes
RL   cedex, FRANCE.
XX
RN   [2]
RA   Gagne K., Bonneville F., Cheneau M.L., Herry P., Pinson M.J., Fouchet M.,
RA   Ferjani L., Jolivot M., Devys A., Cesbron A.;
RT   "homo sapiens partial HLA-DRB1 allele for MHC class II antigen; HLA-DRB1*01
RT   NEW allele, exon 2";
RL   Unpublished.
XX
DR   MD5; 2d9cf6a46ef4aae2c796d7f785d38790.
DR   IMGT/HLA; DRB1*01:56; HLA09110.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="37622"
FT                   /cell_type="PBL"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:L0RH33"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:L0RH33"
FT                   /protein_id="CCO56219.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPAAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 63 C; 99 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer