spacer

EBI Dbfetch

ID   HF549027; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HF549027;
XX
DT   07-JAN-2013 (Rel. 115, Created)
DT   07-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele HLA-A*29,
DE   cell line 57863, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   GAGNE K.;
RT   ;
RL   Submitted (02-NOV-2012) to the INSDC.
RL   EFS Pays de la Loire, Laboratoire HLA, 34 bd Jean Monnet, F-44011 Nantes
RL   cedex, FRANCE.
XX
RN   [2]
RA   Gagne K., Bonneville F., Cheneau M.L., Herry P., Pinson M.J., Fouchet M.,
RA   Ferjani L., Jolivot M., Devys A., Cesbron A.;
RT   "Homo sapiens partial HLA-A allele for MHC class I antigen; HLA-A*29NEW
RT   allele; exons 2-3";
RL   Unpublished.
XX
DR   MD5; 22a9ef7877c89a72f884104c41898198.
DR   IMGT/HLA; A*29:50; HLA09113.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="57863"
FT                   /cell_type="PBL"
FT                   /tissue_type="perpheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT                   /number=2
FT   CDS             join(<74..270,371..>619)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:L0RH54"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L0RH54"
FT                   /protein_id="CCO56217.1"
FT                   /translation="GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQ
FT                   SQTDRANLGTLRGYYNQSEAGSHTIQMMYGCDVESDGRFLRGYRQDAYDGKDYIALNED
FT                   LRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLE"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 163 C; 196 G; 79 T; 100 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcaccgt ggatagagca ggaggggccg gagtattggg       180
     acctgcagac acggaatgtg aaggcccagt cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtgga gtcggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccttgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer