spacer

EBI Dbfetch

ID   HF549026; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HF549026;
XX
DT   07-JAN-2013 (Rel. 115, Created)
DT   07-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*08,
DE   exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   GAGNE K.;
RT   ;
RL   Submitted (02-NOV-2012) to the INSDC.
RL   EFS Pays de la Loire, Laboratoire HLA, 34 bd Jean Monnet, F-44011 Nantes
RL   cedex, FRANCE.
XX
RN   [2]
RA   Gagne K., Bonneville F., Cheneau M.L., Herry P., Pinson M.J., Fouchet M.,
RA   Ferjani L., Jolivot M., Devys A., Cesbron A.;
RT   "Homo sapiens partial HLA-B allele for MHC class I antigen; HLA-B*08NEW
RT   allele; exons 2-3";
RL   Unpublished.
XX
DR   MD5; feb7f6f150cab8c61bfd0543f6255a8c.
DR   IMGT/HLA; B*08:106; HLA09112.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="47583"
FT                   /cell_type="PBL"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=2
FT   CDS             join(<74..270,371..>619)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:L0RFL6"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L0RFL6"
FT                   /protein_id="CCO56216.1"
FT                   /translation="GYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDWNTQIFKTN
FT                   TQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNED
FT                   LRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLE"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=3
XX
SQ   Sequence 646 BP; 114 A; 172 C; 191 G; 69 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     actggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcgg                      646
//


spacer
spacer