spacer

EBI Dbfetch

ID   HF549025; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HF549025;
XX
DT   07-JAN-2013 (Rel. 115, Created)
DT   07-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele HLA-C*01,
DE   exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   GAGNE K.;
RT   ;
RL   Submitted (02-NOV-2012) to the INSDC.
RL   EFS Pays de la Loire, Laboratoire HLA, 34 bd Jean Monnet, F-44011 Nantes
RL   cedex, FRANCE.
XX
RN   [2]
RA   Gagne K., Bonneville F., Cheneau M.L., Herry P., Pinson M.J., Fouchet M.,
RA   Ferjani L., Jolivot M., Devys A., Cesbron A.;
RT   "Homo sapiens partial HLA-C allele for MHC class I; HLA-C*01NEW allele;
RT   exons 2-3";
RL   Unpublished.
XX
DR   MD5; e4aecf057a201f49c7b80d8954c4ce31.
DR   IMGT/HLA; C*01:75; HLA09111.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="39742"
FT                   /cell_type="PBL"
FT                   /tissue_type="perpheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01"
FT                   /number=2
FT   CDS             join(<74..270,371..>619)
FT                   /codon_start=2
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:L0RFH7"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:L0RFH7"
FT                   /protein_id="CCO56215.1"
FT                   /translation="GYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQ
FT                   AQTDRVSLRNLRGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNED
FT                   LRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLE"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01"
FT                   /number=3
XX
SQ   Sequence 646 BP; 105 A; 171 C; 198 G; 72 T; 100 other;
     gctcccactc catgaagtat tccttcacat ccgtgtcccg gcctggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtgtggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer