Dbfetch

ID   HF549021; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HF549021;
XX
DT   07-JAN-2013 (Rel. 115, Created)
DT   07-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*44,
DE   exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Gagne K.;
RT   ;
RL   Submitted (02-NOV-2012) to the INSDC.
RL   EFS Pays de la Loire, Laboratoire HLA, 34 bd Jean Monnet, F-44011 Nantes
RL   cedex, FRANCE.
XX
RN   [3]
RA   Gagne K., Bonneville F., Cheneau M.L., Herry P., Pinson M.J., Ferjani L.,
RA   Fouchet M., Jolivot M., Devys A., Cesbron A.;
RT   "Homo sapiens partial HLA-B allele for MHC class I antigen; HLA-B*44 new
RT   allele; exons 2-3";
RL   Unpublished.
XX
DR   MD5; bdb1001235ef9e1990e5b7d919f579b3.
DR   IMGT/HLA; B*44:167; HLA08937.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="34927"
FT                   /cell_type="PBL"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=2
FT   CDS             join(<74..270,371..>619)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:L0RFL1"
FT                   /protein_id="CCO56211.1"
FT                   /translation="GYVDDTLFVRFDSDATSPRKEPRAPWIEREGPEYWDRETQISKTN
FT                   TQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNED
FT                   LSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVESLRRYLE"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 173 C; 189 G; 72 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagcg ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtatga ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtcg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//