spacer

EBI Dbfetch

ID   HE993878; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HE993878;
XX
DT   20-SEP-2012 (Rel. 114, Created)
DT   20-SEP-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*04:14, exon 2, biomaterial DKMS-LSL-DRB1-14
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Boehme I.;
RT   ;
RL   Submitted (12-SEP-2012) to the INSDC.
RL   Research and Development, DKMS Life Science Lab GmbH, Fiedlerstr. 34,
RL   Saxony, Dresden, D-01307, GERMANY.
XX
RN   [2]
RA   Albrecht V., Boehme I.;
RT   "Characterisation and Confirmation of new HLA-Alleles found by DKMS Life
RT   Science Lab";
RL   Unpublished.
XX
DR   MD5; 0d4de292ca8c6f2da7615105fce624a6.
DR   IMGT/HLA; DRB1*04:133; HLA08800.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /bio_material="DKMS-LSL-DRB1-14"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04:14"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:K0P7G9"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:K0P7G9"
FT                   /protein_id="CCM44110.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVGFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04:14"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 63 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gggcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer