spacer

EBI Dbfetch

ID   HE984353; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   HE984353;
XX
DT   14-SEP-2012 (Rel. 114, Created)
DT   14-SEP-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, alelle
DE   HLA-A*68new, exons 1-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Lu J.;
RT   ;
RL   Submitted (29-AUG-2012) to the INSDC.
RL   Lu J., Room 203, Chinese Marrow Donor Program, No.53 Ganmian Hutong,
RL   Dongcheng District, Beijing 100010, CHINA.
XX
RN   [2]
RA   Liu X., Bi J., Zhang L.B., Wang L.;
RT   "The new HLA allele-HLA-A*68new";
RL   Unpublished.
XX
DR   MD5; 2341f356d16963d77dad7be8c8ce60ed.
DR   IMGT/HLA; A*68:96; HLA08803.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="China:yunnan"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:K0P0H0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:K0P0H0"
FT                   /protein_id="CCM12467.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVDVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..>1195
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68new"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 179 A; 273 C; 308 G; 135 T; 300 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca cttccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacggaat gtgaaggccc agtcacagac tgaccgagtg gacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc       600
     tccgcgggta ccggcaggac gcctacgacg gcaaggatta catcgccctg aaagaggacc       660
     tgcgctcttg gaccgcggcg gacatggcag ctcagaccac caagcacaag tgggaggcgg       720
     cccatgtggc ggagcagtgg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cgcccccaaa acgcatatga ctcaccacgc tgtctctgac       960
     catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca      1080
     ggggatggaa ccttccagaa gtgggtggat gtggtggtgc cttctggaca ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atggg           1195
//


spacer
spacer