spacer

EBI Dbfetch

ID   HE983832; SV 2; linear; genomic DNA; STD; HUM; 1412 BP.
XX
AC   HE983832;
XX
DT   10-SEP-2012 (Rel. 114, Created)
DT   02-SEP-2014 (Rel. 122, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele
DE   HLA-A*30new, exons 1-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Gervais T.;
RT   ;
RL   Submitted (31-AUG-2012) to the INSDC.
RL   UCL Cliniques St Luc, Immunohaematology, Tower R. Franklin - Molecular
RL   Biology -, Level 0 N - Avenue Hippocrate 10, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "New HLA-A*30 allele identified by Sequence Based Typing";
RL   Unpublished.
XX
RN   [3]
RP   1-1412
RA   Gervais T.;
RT   ;
RL   Submitted (02-SEP-2014) to the INSDC.
RL   UCL Cliniques St Luc, Immunohaematology, Tower R. Franklin - Molecular
RL   Biology -, Level 0 N - Avenue Hippocrate 10, Brussels, 1200, BELGIUM.
XX
DR   MD5; 14492c03bec893f8cfe4179f3f97b373.
DR   IMGT/HLA; A*30:68; HLA08775.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1412
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:J7SA67"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:J7SA67"
FT                   /protein_id="CCM09456.2"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHYMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQTDRENLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARRAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSS"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30new"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..>1412
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30new"
FT                   /number=5
XX
SQ   Sequence 1412 BP; 200 A; 311 C; 339 G; 162 T; 400 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctacatgagg tatttctcca catccgtgtc ccggcccggc agtggagagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagagg cctgagtatt gggaccagga       360
     gacacggaat gtgaaggccc actcacagac tgaccgagag aacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag ataatgtatg gctgcgacgt ggggtcggac gggcgcttcc       600
     tccgcgggta tgaacagcac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtcgggc ggagcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cccccccaag acacatatga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca      1080
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagctg tcttcccagc ccaccatccc      1320
     catcgtgggc atcattgctg gcctggttct ccttggagct gtgatcactg gagctgtggt      1380
     cgctgccgtg atgtggagga ggaagagctc ag                                    1412
//


spacer
spacer