spacer

EBI Dbfetch

ID   HE978484; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HE978484;
XX
DT   11-OCT-2012 (Rel. 114, Created)
DT   11-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*12, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lu J.;
RT   ;
RL   Submitted (11-AUG-2012) to the INSDC.
RL   Room 203, Chinese Marrow Donor Program, No.53 Ganmian Hutong,Dongcheng,
RL   District,BeijingBeijing 100010, CHINA.
XX
RN   [2]
RA   Liu X., Wang L., Bi J., Zhang B.L., Xia C.H.;
RT   "Identification of a novel HLA-DRB1 allele";
RL   Unpublished.
XX
DR   MD5; f117e131e67c07c393325648df047ef5.
DR   IMGT/HLA; DRB1*12:37; HLA08580.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:K4REA4"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:K4REA4"
FT                   /protein_id="CCK73144.1"
FT                   /translation="RFLEYSTGECYFFNGTERVPLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 68 C; 97 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     cgttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer