Dbfetch

ID   HE974343; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HE974343;
XX
DT   01-NOV-2012 (Rel. 114, Created)
DT   01-NOV-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele
DE   HLA-B*B*46:01:01, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Zhou X.;
RT   ;
RL   Submitted (29-JUL-2012) to the INSDC.
RL   Molecular Biology Lab, Beijng Institute of Geriatrics, Ministry of Health,
RL   No.1 Dahua Road, Dongdan,Beijing, China, 100730, CHINA.
XX
RN   [2]
RA   Zhou X.Y., Hei A.L., Cai J.P.;
RT   "Identification of a new HLA-B*46 variant by sequence-based typing in a
RT   Chinese Han";
RL   Unpublished.
XX
DR   MD5; 75de9b2a92b0f4739323166406cebbef.
DR   IMGT/HLA; B*46:37; HLA08563.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*B*46:01:01"
FT                   /number=2
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46:01:01"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:K4RGH3"
FT                   /protein_id="CCK33658.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQKYKRQAHTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46:01:01"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 172 C; 197 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacacactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//