spacer

EBI Dbfetch

ID   HE966413; SV 1; linear; genomic DNA; STD; HUM; 3104 BP.
XX
AC   HE966413;
XX
DT   23-JUL-2012 (Rel. 113, Created)
DT   23-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene MHC class I antigen, allele HLA-A*02:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3104
RA   Witter K.;
RT   ;
RL   Submitted (19-JUL-2012) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "A novel HLA-A allele, A*02*new was revealed in a leukemia patient and his
RT   family";
RL   Unpublished.
XX
DR   MD5; 79dba7660c7fa948d23f2703e80eab7a.
DR   IMGT/HLA; A*02:376; HLA08558.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3104
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(120..192,323..592,834..1109,1710..1985,2085..2201,
FT                   2640..2672,2815..2862,3032..3036)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I7LL24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I7LL24"
FT                   /protein_id="CCJ51909.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASRRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTLQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGLCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <120..192
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=1
FT   intron          193..322
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=1
FT   exon            323..592
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=2
FT   intron          593..833
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=2
FT   exon            834..1109
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=3
FT   intron          1110..1709
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=3
FT   exon            1710..1985
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=4
FT   intron          1986..2084
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=4
FT   exon            2085..2201
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=5
FT   intron          2202..2639
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=5
FT   exon            2640..2672
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=6
FT   intron          2673..2814
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=6
FT   exon            2815..2862
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=7
FT   intron          2863..3031
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=7
FT   exon            3032..>3036
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:new"
FT                   /number=8
XX
SQ   Sequence 3104 BP; 601 A; 888 C; 961 G; 654 T; 0 other;
     cccagttctc actcccattg ggtgtcgggt ttccagagaa gccaatcagt gtcgtcgcgg        60
     tcgcggttct aaagtccgca cgcacccacc gggactcaga ttctccccag acgccgagga       120
     tggccgtcat ggcgccccga accctcgtcc tgctactctc gggggctctg gccctgaccc       180
     agacctgggc gggtgagtgc ggggtcggga gggaaacggc ctctgtgggg agaagcaacg       240
     ggcccgcctg gcgggggcgc aggacccggg aagccgcgcc gggaggaggg tcgggcgggt       300
     ctcagccact cctcgtcccc aggctctcac tccatgaggt atttctacac ctccgtgtcc       360
     cggcccggcc gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacgcagttc       420
     gtgcggttcg acagcgacgc cgcgagccgg aggatggagc cgcgggcgcc gtggatagag       480
     caggagggtc cggagtattg ggacggggag acacggaaag tgaaggccca ctcacagact       540
     caccgagtgg acctggggac cctgcgcggc tactacaacc agagcgaggc cggtgagtga       600
     ccccggcccg gggcgcaggt cacgacctct catcccccac ggacgggcca ggtcgcccac       660
     agtctccggg tccgagatcc gccccgaagc cgcgggaccc cgagaccctt gccccgggag       720
     aggcccaggc gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc ccccaggttg       780
     gtcggggcgg ggcggggctc gggggaccgg gctgaccgcg gggtccgggc caggttctca       840
     caccctccag aggatgtatg gctgcgacgt ggggtcggac tggcgcttcc tgcgcgggta       900
     ccaccagtac gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg       960
     gaccgcggcg gacatggcag ctcagaccac caagcacaag tgggaggcgg cccatgtggc      1020
     ggagcagtgg agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga      1080
     gaacgggaag gagacgctgc agcgcacggg taccaggggc cacggggcgc ctccctgatc      1140
     gcctgtagat ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta      1200
     gaatatcgcc ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt      1260
     accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc      1320
     tgaaggaatg acgggaagac gatccctcga atactgatga gtggttccct ttgacacaca      1380
     caggcagcag ccttgggccc gtgacttttc ctctcaggcc ttgttctctg cttcacactc      1440
     aatgtgtgtg ggggtctgag tccagcactt ctgagtccct cagcctccac tcaggtcagg      1500
     accagaagtc gctgttccct cttcagggac tagaattttc cacggaatag gagattatcc      1560
     caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc ccttccccat cccaggtgtc      1620
     ctgtccattc tcaagatagc cacatgtgtg ctggaggagt gtcccatgac agatgcaaaa      1680
     tgcctgaatg atctgactct tcctgacaga cgcccccaaa acgcatatga ctcaccacgc      1740
     tgtctctgac catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat      1800
     cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac      1860
     caggcctgca ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaca      1920
     ggagcagaga tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag      1980
     atggggtaag gagggagacg ggggtgtcat gtcttttagg gaaagcagga gcctctctga      2040
     cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagccgt cttcccagcc      2100
     caccatcccc atcgtgggca tcattgctgg cctggttctc tttggagctg tgatcactgg      2160
     agctgtggtc gctgctgtga tgtggaggag gaagagctca ggtggggaag gggtgaaggg      2220
     tgggtctgag atttcttgtc tcactgaggg ttccaagacc caggtagaag tgtgccctgc      2280
     ctcgttactg ggaagcacca cccacaatta tgggcctacc cagcctgggc cctgtgtgcc      2340
     agcacttact cttttgtaaa gcacctgtta aaatgaagga cagatttatc accttgatta      2400
     cagcggtgat gggacctgat cccagcagtc acaagtcaca ggggaaggtc cctgaggacc      2460
     ttcaggaggg cggttggtcc aggacccaca cctgctttct tcatgtttcc tgatcccgcc      2520
     ctgggtctgc agtcacacat ttctggaaac ttctctgagg tccaagactt ggaggttcct      2580
     ctaggacctt aaggccctga ctcctttctg gtatctcaca ggacattttc ttcccacaga      2640
     tagaaaagga gggagctact ctcaggctgc aagtaagtat gaaggaggct gatgcctgag      2700
     gtccttggga tattgtgttt gggagcccat gggggagctc acccacccca caattcctcc      2760
     tctagccaca tcttctgtgg gatctgacca ggttctgttt ttgttctacc ccaggcagtg      2820
     acagtgccca gggctctgat gtgtctctca cagcttgtaa aggtgagagc ctggagggcc      2880
     tgatgtgtgt tgggtgttgg gcggaacagt ggacacagct gtgctatggg gtttctttcc      2940
     attggatgta ttgagcatgc gatgggctgt ttaaagtgtg acccctcact gtgacagata      3000
     cgaatttgtt catgaatatt tttttctata gtgtgagaca gctgccttgt gtgggactga      3060
     gaggcaagag ttgttcctgc ccttcccttt gtgacttgaa gaac                       3104
//


spacer
spacer