Dbfetch

ID   HE966412; SV 1; linear; genomic DNA; STD; HUM; 5926 BP.
XX
AC   HE966412;
XX
DT   23-JUL-2012 (Rel. 113, Created)
DT   23-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DQA1 gene for MHC class II antigen, allele HLA-DQA1*01:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5926
RA   Witter K.;
RT   ;
RL   Submitted (18-JUL-2012) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Group-specific amplification of HLA-DQA1 revealed a number of genomic full
RT   length sequences including the novel allele DQA1*01:new";
RL   Unpublished.
XX
DR   MD5; 18894dd38987f5ffd32b9896a4a7f732.
DR   IMGT/HLA; DQA1*01:11; HLA08433.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5926
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(305..386,4157..4405,4819..5100,5457..5611)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I7KE75"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7KE75"
FT                   /protein_id="CCJ51908.1"
FT                   /translation="MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPS
FT                   GQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYN
FT                   STAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSF
FT                   LSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEILAPMSELTETVVCA
FT                   LGLSVGLMGIVVGTVFIIQGLRSVGASRHQGPL"
FT   exon            <305..386
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=1
FT   intron          387..4156
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=1
FT   exon            4157..4405
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=2
FT   intron          4406..4818
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=2
FT   exon            4819..5100
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=3
FT   intron          5101..5456
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=3
FT   exon            5457..>5611
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=4
XX
SQ   Sequence 5926 BP; 1705 A; 1259 C; 1310 G; 1652 T; 0 other;
     tggcagacat gcacacacca gagaagattc caatttaatg tcctcccttt attcatagaa        60
     caattcctca agtccactct gagtagaggc tgcatcacaa ggggattgcc ccgtctcctt       120
     ccagggctct taatacaaac tcttcaacta gtaactgaga tgtcaccata ggggattttt       180
     ctaattggcc aaaacctgac ttggcagggt ttggtttggg tgtcttcaga tttccttgtc       240
     ttgaggtcct cacaattact ctacagctca gaacaccaac tgctgaggct gccttgggaa       300
     gaggatgatc ctaaacaaag ctctgctgct gggggccctc gctctgacca ccgtgatgag       360
     cccctgtgga ggtgaagaca ttgtgggtga gtgcatgagt gagggatgtt ctctggagct       420
     gaaaaacagt aaattgaagg aaaagagata aagcgatttg cagagaaact gtagagattt       480
     cctaagggcc ctttcagtat taagacaatt aaaaattata gctgttcctc cttcaggaaa       540
     ccagagcccc aacctactct ttttgttatc tatgctgttg tgttcactaa ggacgctatt       600
     ctgtttatat tatattcagt gactacggcc tggaggtctc tatgtcgttc catcatgatt       660
     gcctcaaaaa ttagtgaggt ttccatcagt ggataatttt ttattattaa aaatttatga       720
     agtgtcattc tcaaatttcc ctgaacaact tttgaagctt ttcggatgtc tccggtggta       780
     gatcttgggg tcattccatc aattatgtac tctatagata tttaaaatgt tgcccgtttc       840
     tttctctcag acttactcac atttccacat gggaactggc acaggtgggg agtgggtaaa       900
     ggagtccagc aggctgaatg ccttcaacaa tcattttacc acatggtcct cacttactct       960
     cagctgcctc atatgtgtca cctcacaagt aatcaaataa aatgggcatg tggctaagct      1020
     ttgtaaatag tgaaaacatg aatgtcaatt ttttttacat atttctatta cagatatagc      1080
     ttcacatttc ttttctttag caaaataagg gatcatttta ttttaaaatt gagaagtaga      1140
     aaaaattggt aaaataaatc attttattct caaattatca acccaaatta cctgttcttc      1200
     acctcatcta ataaagtcct ataaaaagaa aagtgggcca gacaaggtgg ctcatgcctg      1260
     taatcccagc actttgggag gccgaggcag gaggatcatt tgagcctggg agcttgagac      1320
     cagcctgggc aacatagcaa gacctcatct ctacaaaaaa agaaaaataa aaattagcca      1380
     ggcatggtgg tgtgtgcctg tggtgccagc tactcagaag gctgccgtgg gaggaccact      1440
     tgagtccatg aggcggaagc tgcagtgagc catggtggca ccactacact ccagccaggg      1500
     caacagagag aggcgctgtc tcaaaaagaa agaggaaaga aagcgaggaa ggaaggaagg      1560
     aaggagaagg aaggaaggaa ggaaaagaaa agaaaaggga agggaggaag gaagggaaaa      1620
     agaaagacag aaagaaagag gaaggaagga agaaaggaag cacagattaa ttatttggtc      1680
     tcttactctc ctctgccttt gtcgtccatc tctttccacc tctcttcatg catccctttc      1740
     tccctcttcc ctttcaggat ccatctctga ctccctgctc ctttatagag atggacagtg      1800
     ggtttgtaaa acaaaagttg aaaagtcaga tagttaaaag gggaagtgaa ctggaaggta      1860
     ctttaaactt tcacaacttt attaaccgtg gctgctccca ttatgatttt gttcggcagt      1920
     ggaagtttca cctgcttctc cagagcgctt ggcgtctttg ttccaaattt cctttcttca      1980
     acctcacacc agagtgccct ggtcaggctt ggctcattca ttaggcacaa tgtgggcagt      2040
     gcaggggacc ctccatactg taaagccaca tgagaaggtt ttaactcctt ttaaaattag      2100
     aaaaataatg gaatattaga gcctaagaaa atgttttaac ttttaattca gcctagatta      2160
     tattgtcttt ataccaattc agtcataaaa tataattttc catatttttg tggaggaaga      2220
     ggcccataca agcaagaatg ctcggggctc acatgtcaga atgcagcctt ggtcatgact      2280
     gatcctggcc ttcgtatggt tctgctacct gtgtgcctgc ccgtcttccc caaaatctat      2340
     gtggtcctcg aatatagcaa ctgtcattca atacacatgt ttgagcacac agtgagctaa      2400
     gttttaagga ttcaaagatg aaaagtcatg ctgtcttccc tgcagagggt gctcagatta      2460
     gtgatggaaa cagtatgggg tgcaggaaag cagaaggcca ttgctgagca gggcagtgga      2520
     cccagcagag gctgaaacaa tacaagtgac ttggttccag gtgggccagc agggtgacgt      2580
     cctctagcaa aatttggcac ccaagacaag taccagaaga aaagaaagac tgcatgtatt      2640
     ccacatatat tcatgtttga acaaggagtc aagatttatg gcaaggataa ggaggctttg      2700
     ttggtgacct gttaagacca accagggcag tcatgctgga tagggaagaa ggtgagctgg      2760
     aagaggaaca gacaacttgg acagccagat gttgagacgg aggggttgga ggtcataatg      2820
     tggtcaaaaa catgttgatg agaggactca gctacaaagt tgttaactta agcagaaacc      2880
     tcaaggatgg attttagaat ttctccagga agtcctaaaa gataattcca tttcagggag      2940
     aaaaacaaca gaccactgca aagaccaggg aacatgaaag gataatgtag tttgtcttgc      3000
     ttggcagata cttttgaagg atgttggact gtaaggctgt cgatatcctc ctcagagaac      3060
     ttactacagt acattgtatc tgttccctta cctacctgac tcttccacta ttcagtttgt      3120
     tccttaatag tagaccatgc ctgattggtg ttttacacat ctccggctat gtctgacact      3180
     tgtggatgct cagaaagtgg ggaaggaagg aaagatacga tggtaaaagg cttacacatg      3240
     tcttgacaaa aaagtccagt ttggctcatt tggctggagt cgtactgcat ggctgccatt      3300
     ctgctctggc atcctcagac aagcacactg cccattagag gaaaaagtgt gatataagtg      3360
     ttgagtcaga atgctgtaga catttagtaa tctccttcac aggaaaaaaa aaaaaaggtg      3420
     gggggaatga cagaaatcca aaaactagta gagcttccac ttttcatttc agaagaaatc      3480
     agttgctctc ctctaaggac cattactatt aacaaaacag agaccttaga aggaggcatt      3540
     gtttatttat tatatatttt gtaatgttat taccaatctt gttatactct ttcttatacc      3600
     ctacaattgt tagcagaaat tattttaaat taataagatc ctgcatgctt ttcctttaaa      3660
     aaaaaaaaaa aaaaaaagat ctctgtgtag agtgtcctat tctgagccag tcctgagagg      3720
     aaaggaagta taatcaattt gttattaacc aatgaaagaa ttaagtgaaa gataaatctc      3780
     aggaagcaga gggaagtaaa cctaatttct gactaagaaa gctaaatact atgataactc      3840
     attcattcct tcttttgttc aattacatta tttaatcata agtccatgac atgccaggca      3900
     ctcaggaaat agtaaaaatt ggacatgcga tattctgccc ttgtgtagcg cacactagag      3960
     tgggaaagaa agtgcacttt taactggaca actaccaaca tgaagagggg aggaagcagg      4020
     ggctggaaat gtccacagac tgtgccaaaa aatgaagccc ataatatttg aaagtcagtt      4080
     tcttccatca ttttgtgtat taaggttctt tcttcccctg ttctccgcct tcctgcttgt      4140
     catcttcact catcagctga ccacgttgcc tcttgtggtg taaacttgta ccagttttac      4200
     ggtccctctg gccagtacac ccatgaattt gatggagatg agcagttcta cgtggacctg      4260
     gagaggaagg agactgcctg gcggtggcct gagttcagca aatttggagg ttttgacccg      4320
     cagggtgcac tgagaaacat ggctgtggca aaacacaact tgaacatcat gattaaacgc      4380
     tacaactcta ccgctgctac caatggtatg cgtccaccat tctgcctctc tttacttaag      4440
     ttatccctcc ataccagggt tcattatttt cttcccaaga ggtccccaga tcttcttatg      4500
     gcaattgctg aaattttatc atctcccatc tctaaaatca catattccca tgtaatacaa      4560
     gggtctttcc attatgcatt cagcaaatcc ttctaggaga ggtctcatca acctcctact      4620
     ttattaaaca tgcccacaga gagaagggca caggaataaa gcagaggcaa tgtgtcgttg      4680
     ctcccaagca gaaggtaaat aagacctctt tgactatcag gtggtgaaat gctggtagga      4740
     gggctcttcc aggatgtaat gcagaacttc agggcagagc tattcacact tcacaccagt      4800
     gctgtttcct caccacagag gttcctgagg tcacagtgtt ttccaagtct cccgtgacac      4860
     tgggtcagcc caacaccctc atttgtcttg tggacaacat ctttcctcct gtggtcaaca      4920
     tcacatggct gagcaatggg cagtcagtca cagaaggtgt ttctgagacc agcttcctct      4980
     ccaagagtga tcattccttc ttcaagatca gttacctcac cttcctccct tctgctgatg      5040
     agatttatga ctgcaaggtg gagcactggg gcctggacca gcctcttctg aaacactggg      5100
     gtaaggatga gtttcatcat tttttgattc tttcttgtct gtcaagttca gaacttcctg      5160
     ccttttactc ctatatccaa aaacttgttt tccacacttc atgggtttct tttctgtctc      5220
     tctttttttt ttgaaagaat aaagcaaaaa aagcagagat ttattgaaaa tgaaagtaca      5280
     ctctacagga tgggagtggg cctgccactt catggttttc taatgataga cttcactctt      5340
     ctccctaagc ctggggcctt gagtctttgc agagccaacc ctctacccca tcccatccca      5400
     cacacatgca catgagcaca ctctgcattc tgacctcaac aacttcactt ccacagagcc      5460
     tgagattcta gcccctatgt cagagctcac agagactgtg gtctgtgccc tggggttgtc      5520
     tgtgggcctc atgggcattg tggtgggcac tgtcttcatc atccaaggcc tgcgttcagt      5580
     tggtgcttcc agacaccaag ggccattgtg aatcccatcc tggaagggaa ggtaagattg      5640
     agactggtta cagttgaagc ggcagtatga aaggaaggaa agtgggaggg cgttgtggac      5700
     atgaatgtgg ttgaaagttg taggggaatt gggaagtggc atgatgatga cacaggagcc      5760
     ccctcggacc cattgatctc atgtctgccc tgttgcaggt gcatcgccat ctacaggagc      5820
     agaagaatgg acttgctaaa tgacctagca ctattctctg gcccgattta tcatatccct      5880
     tttctcctcc aaatatttct cctctcacct tttctctggg acttaa                     5926
//