spacer

EBI Dbfetch

ID   HE965627; SV 1; linear; genomic DNA; STD; HUM; 5790 BP.
XX
AC   HE965627;
XX
DT   20-JUL-2012 (Rel. 113, Created)
DT   20-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DQA1 gene for MHC class II antigen, allele HLA-DQA1*01:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5790
RA   Witter K.;
RT   ;
RL   Submitted (11-JUL-2012) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Group-specific amplification of HLA-DQA1 revealed a number of genomic full
RT   length sequences including the novel allele DQA1*01:new";
RL   Unpublished.
XX
DR   MD5; 52685ee8463a30a3909841a38e4b9d8b.
DR   IMGT/HLA; DQA1*01:10; HLA08431.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5790
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(330..411,4189..4437,4851..5132,5489..5643)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I7LP05"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7LP05"
FT                   /protein_id="CCJ47270.1"
FT                   /translation="MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPS
FT                   GQFTHEFDGDEQFYVDLEKKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYN
FT                   STTATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHAVTEGVSETSF
FT                   LSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCA
FT                   LGLSVGLVGIVVGTVFIIQGLRSVGASRHQGPL"
FT   exon            <330..411
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=1
FT   intron          412..4188
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=1
FT   exon            4189..4437
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=2
FT   intron          4438..4850
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=2
FT   exon            4851..5132
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=3
FT   intron          5133..5488
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=3
FT   exon            5489..>5643
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01:new"
FT                   /number=4
XX
SQ   Sequence 5790 BP; 1676 A; 1220 C; 1293 G; 1601 T; 0 other;
     gaaaaacacc catccctctt gcgactggca gacatgcaca caccagagaa gattccaatt        60
     tagtgtcctc cctttattca tagaacaatt cctcaagtcc actctgagta gaggctgcat       120
     cacaagggga ttgccccgtc tccttccagg gctcttaata caaactcttc aactagtaac       180
     tgagatgtca ccatagggga tttttctaat tggccaaaac ctgacttggc agggtttggt       240
     ttgggtgtct tcagatttcc ttgtcttgag gtcctcacaa ttactctaca gctcagaaca       300
     ccaactgctg aggctgcctt gggaagagga tgatcctaaa caaagctctg ctgctggggg       360
     ccctcgctct gaccaccgtg atgagcccct gtggaggtga agacattgtg ggtgagtgca       420
     tgagtgaggg atgttctctg gagctgaaaa acagtaaatt gaaggaaaag agataaagcg       480
     atttgcagag aaactgtaga gatttcctaa gggccctttc agtattaaga caattaaaaa       540
     ttatagctgt tcctccttca ggaaaccaga gccccaacct actctttttg ttatctatgc       600
     tgttgtgttc actaaggacg ctattctgtt tatattatat tcagtgacta cagcctggag       660
     gtctctatgt cgttccatca tgattgcctc aaaaattagt gaggtttcca tcagtggata       720
     attttttatt attaaaaatt tatgaagtgt cattctcaaa tttccctgaa caacttttga       780
     agcttttcgg atgtctccgg tggtagatct tggggtcatt ccatcaatta tgtactctat       840
     agatatttaa aatgttgccc gtttctttct ctcagactta ctcacatttc cacatgggaa       900
     ctggcacagg tggggagtgg gtaaaggagt ccagcaggct gaatgccttc aacagtcatt       960
     ttaccacatg gtcctcactt actctcagct gcctcatatg tgtcacctca caagtaatca      1020
     aataaaatgg gcatgtggct aagttttgta aatagtgaaa acatgaatgt caattttttt      1080
     tacatatttc tattacagat atagcttcac atttcttttc tttagcaaaa taagggatca      1140
     ttttatttta aaattgagaa gtagaaaaaa ttggtaaaat aaatcatttt attctcaaat      1200
     tatcaaccca aattacctgt tcttcacctc atctaataaa gtcctataaa aagaaaagtg      1260
     ggccagacaa ggtggctcat gcctgtaatc ccagcacttt gggaggccga ggcaggagga      1320
     tcatttgagc ctgggagctt gagaccagcc tgggcaacat agcaagacct catctctaca      1380
     aaaaaagaaa aataaaaatt agccaggcat ggtggtgtgt gcctgtggtg ccagctactc      1440
     agaaggctgc cgtgggagga ccacttgagt ccatgaggcg gaagctgcag tgagccatga      1500
     tggcaccact acactccagc cagggcaaca gagagagact ctgtctcaaa aagaaagagg      1560
     aaagaaagca aggaaccaag gaaggaagga aggaaggaga aggaaggaag gaaaagaaaa      1620
     gaaaagggaa gggaggaagg aaggaaaaaa gaaagacgga aagaaaaagg aaggaaggaa      1680
     gaaaggaagc acagattaat tatttggtct cttactctcc tctgcctttg tcgtccatct      1740
     ctttccacct ctcttgatgc attcctttct cccccttccc tttcaggatc cacctctggc      1800
     tccctgctcc tttatagata tggacagtgg gtttgtaaag caaaagttga aaagtcagat      1860
     agttaaaagg ggaagtgaac tggaaggtac tctaaacttt cacaacttta ttaaccgtgg      1920
     ctgctcccat tatgattttg ttcggcagtg gaagtttcac ctgcttctcc agagcacttg      1980
     gcatctttgt tccaaatttc ctttcttcag cctcacacca gagtgccctg gtcaggctcg      2040
     gctcatccat taggcactat gtgggcagtg caggggaccc tccatactgt aaagccacat      2100
     gagaaggttt taacaccttt taaaattaga aaaataatgg aatattagag cctaagaaaa      2160
     tgttttaact tttaattcag cctagattat attgtcttta taccaattca gtcataaaat      2220
     ataattttcc atatttttat ggaggaaggg gcccatacaa gcaagaatgc tcggggctca      2280
     catgtcagaa tgcagccttg gtcatgactg atcctggcgt ttgtatggtt ctgctacctg      2340
     tgtgcctgtc cgtcttcccc aaaatctgtg tggtcctcga atatagcaac tgtcattcaa      2400
     tacacatgtt tgagcacaca gtgagctaag ttttaaggat tcaaagatga aaagtcatgc      2460
     tgtcttccct gcagagggtg ctcagattag tgatggaaac agtgtggggt gcaggaaagc      2520
     agaaggccat tgctgagcag ggcagtggac ccagcagagg ctgaaacaat acaagtgact      2580
     tggttccagg tgggccagca gggtgacgtc ctctagcaaa atttggcacc caagacaagt      2640
     accagaagaa aagaaagact gcatgtattc cacatatatt catgtttgaa caaggagtca      2700
     agatttatgg caaggataag gaggctttgt tggtgacctg ttaagaccaa ccagggcagt      2760
     catgctggat agggaagaag gtgagctgga agaggaacag acaaacttgg acagccagat      2820
     gttgagatgg aggggttgga ggtcataatg tggtcaaaac atgttgatga gaggactcag      2880
     ctacaaagtt gttaacttaa gcagaaacct caaggatgga ttttagaatt tctccaggaa      2940
     gtcctaaaag ataattcctt ttcagggaga aaaacaacag accactgcaa agaccaggga      3000
     acatgaaagg ataatgtagt ttggcttgct tggcagatac ttttgaagga tgttggactg      3060
     taaggctgtc gatatcctcc tcacagaact tactacagta cattgtatct gttcccttac      3120
     ctacctgact cttccactat tcagtttgtt ccttaatggt agaccatgcc tgattggtgt      3180
     tttacacatc tccggctatg tctgacactt gtggatgctc agaaagtggg gaaggaagga      3240
     aagatacgat ggtaaaaggc ttacacatgt cttgacaaga aagtccagtt cggctcattt      3300
     ggctggagtc gtactgcatg gctgccattc tgctctggca tcctcagaca agcacactgc      3360
     ccattagagg aaaaagtgtg aatataagtg ttgagtcaga atgctgtaga catttagtaa      3420
     cctccttcac aggaaaaaaa aaagatgggg ggaatgacag aaatccaaaa actagtagag      3480
     cttccacttt tcatttcaga agaaatcagt tgctctccta taaggaccat tactattaac      3540
     aaaacagaga ccttagaagg aggcattgtt tatttattat atattttgta atgttattac      3600
     caatcttgtt atactctttc ttatacccta caattgttag cagaaattat tttaaattaa      3660
     taagatcctg catgcttttc cttaaaaaaa aaaaaaagaa agaaagaaag atctctgtgt      3720
     agagtgtcct attctgagcc agtcctgaga ggaaaggaag tataatcaat ttgttattaa      3780
     ccgatgaaag aattaagtga aagataaatc tcaggaagca gagggaagta aacctaatct      3840
     ctgactaaga aagctaaata ctatgataac tcattcattc cttcttttgt tcaattacat      3900
     tatttaatca taagtccatg acgtgccagg cactcaggaa atagtaaaaa ttggacgtgc      3960
     gatattctgc ccttgtgtag cgcacactag agtgggaaag aaagtgcact tttaactgga      4020
     caactaccaa catgatgagg ggaggaaaca ggggctggaa atgtccacgg actgtgccga      4080
     aaaatgaagc ccataatatt tgaaagtcag tttcttccat cattttgtgt attaaggttc      4140
     tttcttcccc tgttctccgc cttcctgctt gtcatcttca ctcatcagct gaccatgttg      4200
     cctcttgtgg tgtaaacttg taccagtttt acggtccctc tggccagttc acccatgaat      4260
     ttgatggaga tgagcagttc tacgtggacc tggagaagaa ggagactgcc tggcggtggc      4320
     ctgagttcag caaatttgga ggttttgacc cgcagggtgc actgagaaac atggctgtgg      4380
     caaaacacaa cttgaacatc atgattaaac gctacaactc taccactgct accaatggta      4440
     tgcgtccacc attctgcctc tctttactta agctatccct tcataccagg gttcattatt      4500
     ttcttcccaa gaggtcccca gatcttctta tggcaattgc tgaaatttta tcatctccca      4560
     tctctaaaat cacatattcc catgtaatac aagggtcttt ccattatgca ttcagcaaat      4620
     ccttctagga gaggtctcat caacctccta ctttattaaa catgcccaca gagagaaggg      4680
     cacaggaata aagcagaggc aatgtgtcat tgctcccaag cagaaggtaa ataagacctc      4740
     tttgactatc aggtggtgaa atgctggtag gagggctctt ccaggatgta atgcagaact      4800
     tcagggcaga gctattcaca cttcacacca gtgctgtttc ctcaccacag aggttcctga      4860
     ggtcacagtg ttttccaagt ctcccgtgac actgggtcag cccaacaccc tcatctgtct      4920
     tgtggacaac atctttcctc ctgtggtcaa catcacatgg ctgagcaatg ggcacgcagt      4980
     cacagaaggt gtttctgaga ccagcttcct ctccaagagt gatcattcct tcttcaagat      5040
     cagttacctc accttcctcc cttctgctga tgagatttat gactgcaagg tggagcactg      5100
     gggcctggac cagcctcttc tgaaacactg gggtaaggat gagtttcatc attttttgat      5160
     tctttcttgt ctgtcaggtt cagaacttcc tgccttttac tcctatatcc aaaaacttgt      5220
     tttccacact tcatgggttt cttttctgtc tcactttttt ttttgaaaga ataaagcaaa      5280
     aaaagcagag atttattgaa aatgaaagta cactctacag gatgggagtg ggcctgccac      5340
     ttcatggttt tctaatgata gacttcactc tcctccctaa gctgggggcc ttgagtcttt      5400
     gtagagccaa ccctgtaccc catcccatcc cacacacatg cacatgagca aactctgcat      5460
     tctgacctca acaacttcac ttccacagag cctgagattc cagcccctat gtcagagctc      5520
     acagagactg tggtctgtgc cctggggttg tctgtgggcc tcgtgggcat tgtggtgggc      5580
     actgtcttca tcatccaagg cctgcgttca gttggtgctt ccagacacca agggcccttg      5640
     tgaatcccat cctggaaggg aaggtaagat tgagactggt tacagttgaa gcggcagtat      5700
     gaaaggaagg aaagtgggag ggcgttgtgg acatgaatgt ggtttaaagt tgtaggggaa      5760
     ttgggaagtg gcatgatgat gacacaggac                                       5790
//


spacer
spacer