Dbfetch

ID   HE860493; SV 2; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   HE860493;
XX
DT   15-JUN-2012 (Rel. 113, Created)
DT   22-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*18,
DE   exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Vecchiato C.;
RT   ;
RL   Submitted (11-JUN-2012) to the INSDC.
RL   Lab. di Immunogenetica S.I.T, Ospedale di Bolzano, Via Lorenz Boehler, 5,
RL   39100, ITALY.
XX
RN   [2]
RA   Vecchiato C., Lochmann E., Frison S., Poli F., Moscetti A.;
RT   "A novel HLA-B*18 allele identified by SBT typing in an Italian bone marrow
RT   volunteer donor";
RL   Unpublished.
XX
RN   [3]
RP   1-792
RA   Vecchiato C.;
RT   ;
RL   Submitted (20-JUN-2012) to the INSDC.
RL   Lab. di Immunogenetica S.I.T, Ospedale di Bolzano, Via Lorenz Boehler, 5,
RL   39100, ITALY.
XX
DR   MD5; 8cb762bc3ddaf98da8b216153c243e29.
DR   IMGT/HLA; B*18:80; HLA08403.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..269,517..>742)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:I4IY78"
FT                   /protein_id="CCI69287.2"
FT                   /translation="LPLHEVFPHLRVPARPRGAPLHHRGLRGRHPVREVRQRRRESEDG
FT                   APGAVDRARGAGVLGPEHTDLQDQHTDLPREPAEPARLLQPERGRSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   V"
FT   exon            1..269
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /number=2
FT   intron          270..516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /number=2
FT   gap             369..381
FT                   /estimated_length=13
FT   exon            517..742
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18"
FT                   /number=3
XX
SQ   Sequence 792 BP; 139 A; 265 C; 276 G; 99 T; 13 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgann nnnnnnnnnn ngcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagaggatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagacacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//