Dbfetch

ID   HE858252; SV 1; linear; genomic DNA; STD; HUM; 922 BP.
XX
AC   HE858252;
XX
DT   13-AUG-2012 (Rel. 113, Created)
DT   13-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*40
DE   variant, exons 3-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-922
RA   Yang E.;
RT   ;
RL   Submitted (12-JUN-2012) to the INSDC.
RL   Buddhist Tzu Chi General Hospital, Tzu Chi Stem Cells Center, 707 Section 3
RL   Chung Yang Road, Hualien 970, TAIWAN.
XX
RN   [2]
RA   Yang K.L.;
RT   "Discovery of a new HLA-B*40 allele in Taiwan";
RL   Unpublished.
XX
DR   MD5; af33b439e3669dcee83febc3c0e55814.
DR   IMGT/HLA; B*40:221; HLA08407.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..922
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..546,647..>922)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:J7QCI8"
FT                   /protein_id="CCI61354.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHERLPKPLTLRW"
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=3
FT   gap             547..646
FT                   /estimated_length=unknown
FT   exon            647..922
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=4
XX
SQ   Sequence 922 BP; 182 A; 255 C; 270 G; 115 T; 100 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatctccca gcgcaagttg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac aagctggagc       540
     gcgctgnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca       660
     cacgtgaccc accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggt       720
     ttctaccctg cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac       780
     actgagcttg tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg       840
     gtggtgcctt ctggagaaga gcagagatac acatgccatg tacagcatga gaggctgccg       900
     aagcccctca ccctgagatg gg                                                922
//