spacer

EBI Dbfetch

ID   HE858250; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HE858250;
XX
DT   05-AUG-2012 (Rel. 113, Created)
DT   05-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*04 variant, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Yang E.;
RT   ;
RL   Submitted (04-JUN-2012) to the INSDC.
RL   Buddhist Tzu Chi General Hospital, Tzu Chi Stem Cells Center, 707 Section 3
RL   Chung Yang Road, Hualien 970, TAIWAN.
XX
RN   [2]
RA   Yang K.L.;
RT   "Discovery of a new HLA-DRB1*04 allele in Taiwan";
RL   Unpublished.
XX
DR   MD5; 78a16601e24cf501b90242b95b18a094.
DR   IMGT/HLA; DRB1*04:05:15; HLA08408.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I7JI15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I7JI15"
FT                   /protein_id="CCI61352.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 65 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtatgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer