spacer

EBI Dbfetch

ID   HE817759; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HE817759;
XX
DT   08-JUL-2012 (Rel. 113, Created)
DT   08-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*41,
DE   exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Tran H.;
RT   ;
RL   Submitted (08-MAY-2012) to the INSDC.
RL   Transplantation Immunology, University of Heidelberg, Im Neuenheimer Feld
RL   305, Heidelberg 69120, GERMANY.
XX
RN   [2]
RA   Tran T.H., Klages C., Opelz G.;
RT   "Characterization of a new HLA-B*41 allele";
RL   Unpublished.
XX
DR   MD5; d218bb3ad4f0e8e8ff40baad7949ce02.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I7JVZ3"
FT                   /db_xref="IMGT/HLA:B*41:21"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I7JVZ3"
FT                   /protein_id="CCH63753.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 170 C; 193 G; 70 T; 100 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcgg                      646
//


spacer
spacer