Dbfetch

ID   HE817758; SV 1; linear; genomic DNA; STD; HUM; 3075 BP.
XX
AC   HE817758;
XX
DT   17-MAY-2012 (Rel. 112, Created)
DT   17-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*66:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3075
RA   Witter K.;
RT   ;
RL   Submitted (10-MAY-2012) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "A novel HLA-A allele, A*66:new, was revealed in a leukemia patient's
RT   family";
RL   Unpublished.
XX
DR   MD5; 5f0734606934302fccb508a2f5d3b915.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3075
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="leukemia patient"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(91..163,294..563,805..1080,1681..1956,2056..2172,
FT                   2611..2643,2786..2833,3003..3007)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentating molecule"
FT                   /db_xref="GOA:I2HA75"
FT                   /db_xref="IMGT/HLA:A*66:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:I2HA75"
FT                   /protein_id="CCH63752.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPVEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            <91..163
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=1
FT   intron          164..293
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=1
FT   exon            294..563
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=2
FT   intron          564..804
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=2
FT   exon            805..1080
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=3
FT   intron          1081..1680
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=3
FT   variation       1654
FT                   /replace="t"
FT                   /compare=HM357868.1
FT   exon            1681..1956
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=4
FT   intron          1957..2055
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=4
FT   exon            2056..2172
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=5
FT   intron          2173..2610
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=5
FT   exon            2611..2643
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=6
FT   intron          2644..2785
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=6
FT   exon            2786..2833
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=7
FT   intron          2834..3002
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=7
FT   exon            3003..>3007
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66:new"
FT                   /number=8
XX
SQ   Sequence 3075 BP; 590 A; 880 C; 961 G; 644 T; 0 other;
     tttccagaga agccaatcag tgtcgtcgcg gtcgcggttc taaagtccgc acgcacccac        60
     cgggactcag attctcccca gacgccgagg atggccgtca tggcgccccg aaccctcgtc       120
     ctgctactct cgggggccct ggccctgacc cagacctggg cgggtgagtg cggggtcggg       180
     agggaaacgg cctctgtggg gagaagcaag gggcccgccc ggcgggggcg caggacccgg       240
     gaagccgcgc ctggaggagg gtcgggcggg tctcagccac tcctcgcccc caggctccca       300
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       360
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       420
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       480
     cacacggaat gtgaaggccc agtcacagac tgaccgagtg gacctgggga ccctgcgcgg       540
     ctactacaac cagagcgagg acggtgagtg accccggccc ggggcgcagg tcacgacccc       600
     tcatccccca cggacgggcc aggtcgccca cagtctccgg gtccgagatc cgccccgaag       660
     ccgcgggacc ccgagaccct tgccccggga gaggcccagg cgcctttacc cggtttcatt       720
     ttcagtttag gccaaaaatc cccccgggtt ggtcggggcg gggcggggct cgggggaccg       780
     ggctgacctc ggggtccggg ccaggttctc acaccatcca gaggatgtat ggctgcgacg       840
     tggggccgga cgggcgcttc ctccgcgggt accagcagga cgcttacgac ggcaaggatt       900
     acatcgccct gaacgaggac ctgcgctctt ggaccgcggc ggacatggcg gctcagatca       960
     cccagcgcaa gtgggagacg gcccatgagg cggagcagtg gagagcctac ctggagggcc      1020
     ggtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcacgg      1080
     gtaccagggg ccacggggcg cctccctgat cgcctgtaga tctcccgggc tggcctccca      1140
     caaggagggg agacaattgg gaccaacact agaatatcgc cctccctctg gtcctgaggg      1200
     agaggaatcc tcctgggttt ccagatcctg taccagagag tgactctgag gttccgccct      1260
     gctctctgac acaattaagg gataaaatct ctgaaggaat gacgggaaga cgatccctcg      1320
     aatactgatg agtggttccc tttgacacac accggcagca gccttgggcc cgtgactttt      1380
     cctctcaggc cttgttctct gcttcacact caatgtgtgt gggggtctga gtccagcact      1440
     tctgagtccc tcagcctcca ctcaggtcag gaccagaagt cgctgttccc tcttcaggga      1500
     ctagaatttt ccacggaata ggagattatc ccaggtgcct gtgtccaggc tggtgtctgg      1560
     gttctgtgct cccttcccca tcccaggtgt cctgtccatt ctcaagatag ccacatgtgt      1620
     gctggaggag tgtcccatga cagatgcaaa atgcctgaat gttctgactc ttcctgacag      1680
     acgcccccaa gacgcatatg actcaccacg ctgtctctga ccatgaggcc accctgaggt      1740
     gctgggccct gagcttctac cctgtggaga tcacactgac ctggcagcgg gatggggagg      1800
     accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatggg accttccaga      1860
     agtgggcgtc tgtggtggtg ccttctggac aggagcagag atacacctgc catgtgcagc      1920
     atgagggtct gcccaagccc ctcaccctga gatggggtaa ggagggagac gggggtgtca      1980
     tgtcttttag ggaaagcagg agcctctctg acctttagca gggtcagggc ccctcacctt      2040
     cccctctttt cccagagccg tcttcccagc ccaccatccc catcgtgggc atcattgctg      2100
     gcctggttct ctttggagct gtgatcgctg gagctgtggt cgctgctgtg atgtggagga      2160
     ggaagagctc aggtggggaa gggatgaagg gtgggtctga gatttcttgt ctcactgagg      2220
     gttccaagac ccaggtagaa gtgtgccctg cctcgttact gggaagcacc atccacaatt      2280
     atgagcctac ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa agcacctgtt      2340
     aaaatgaagg acagatttat caccttgatt acggcggtga tgggacctga tcccagcagt      2400
     cacaagtcac aggggaaggt ccctgaggac cttcaggagg gcggttggtc caggacccac      2460
     acctgctttc ttcatgtttc ctgatcccgc cctgggtctg cagtcacaca tttctggaaa      2520
     cttctctgag gtccaagact tggaggttcc tctaggacct taaggccctg gctcctttct      2580
     ggtatctcac aggacatttt cttcccacag atagaaaagg agggagctac tctcaggctg      2640
     caagtaagta tgaaggaggc tgatgcctga ggtccttggg atattgtgtt tgggagcccg      2700
     tgggggagct cacccacccc acaattcctc ctctagccac atgttctgtg ggatctgacc      2760
     aggttctgtt tttgtcctac cccaggcagt gacagtgccc agggctctga tatgtctctc      2820
     acagcttgta aaggtgagag cctggagggc ctgatgtgtg ttgggtgttg ggcggaacag      2880
     tggacgcagc tgtgctatgg ggtttctttg cattggatgt attgagcatg cgatgggctg      2940
     tttaaagtgt gactcctcac tgtgacagat acgaatttgt tcatgaatat ttttttctat      3000
     agtgtgagac agctgccttg tgtgggactg agaggcaaga tttgttcctg cccttccctt      3060
     tgtgacttga agaac                                                       3075
//