spacer

EBI Dbfetch

ID   HE804194; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   HE804194;
XX
DT   01-JUN-2012 (Rel. 113, Created)
DT   03-SEP-2014 (Rel. 122, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, isolate
DE   D10101571, allele DQB1*03:01:07, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   BGI H.;
RT   ;
RL   Submitted (31-MAR-2012) to the INSDC.
RL   BGI, Main Building 9/F, Beishan Industrial Zone, Yantia, Shenzhen 518083,
RL   CHINA.
XX
RN   [2]
RX   DOI; 10.1111/tan.12167.
RX   PUBMED; 23826662.
RA   Zhang C., Wang Y., Huang C., Zhang M., Chen C., Cao H., Chai X., Li J.;
RT   "Characterization of 27 novel HLA class II alleles from China marrow donor
RT   program";
RL   Tissue Antigens 82(3):201-202(2013).
XX
DR   MD5; f01317cb3b5915fb0b6e1ae19e84c6c7.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Tr; ENST00000399065; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000424530; homo_sapiens.
DR   IMGT/HLA; DQB1*03:01:07; HLA09094.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /isolate="D10101571"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="DQB1*03:01:07"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I4EPE3"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I4EPE3"
FT                   /protein_id="CCH35813.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHG
FT                   DVYTCHVEHPSLQNPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="DQB1*03:01:07"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="DQB1*03:01:07"
FT                   /number=3
XX
SQ   Sequence 652 BP; 129 A; 165 C; 161 G; 97 T; 100 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagagaacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc agtgacagat ttctatccag cccagatcaa agtccggtgg       480
     tttcggaatg accaggagga gacaaccggc gttgtgtcca ccccccttat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcatgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag aaccccatca ccgtggagtg gc               652
//


spacer
spacer