spacer

EBI Dbfetch

ID   HE801225; SV 1; linear; genomic DNA; STD; HUM; 2967 BP.
XX
AC   HE801225;
XX
DT   13-APR-2012 (Rel. 112, Created)
DT   13-APR-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*07:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2967
RA   Witter K.;
RT   ;
RL   Submitted (05-APR-2012) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "A novel HLA-B allele, B*07:xx was revealed in a leukemia patient and
RT   confirmed by allele specific HLA-B amplification";
RL   Unpublished.
XX
DR   MD5; 8cc8227691836b87823ff2228f9b25a1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2967
FT                   /organism="Homo sapiens"
FT                   /isolate="212970"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(93..165,294..563,809..1084,1659..1934,2028..2144,
FT                   2586..2618,2725..2768)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I0LEY6"
FT                   /db_xref="IMGT/HLA:B*07:156"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I0LEY6"
FT                   /protein_id="CCH22527.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPAKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <93..165
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=1
FT   intron          166..293
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=1
FT   exon            294..563
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=2
FT   intron          564..808
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=2
FT   exon            809..1084
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=3
FT   intron          1085..1658
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=3
FT   exon            1659..1934
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=4
FT   intron          1935..2027
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=4
FT   exon            2028..2144
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=5
FT   intron          2145..2585
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=5
FT   exon            2586..2618
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=6
FT   intron          2619..2724
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=6
FT   exon            2725..>2768
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:new"
FT                   /number=7
XX
SQ   Sequence 2967 BP; 554 A; 853 C; 954 G; 606 T; 0 other;
     ggatatctag agaagccaat cagcgtcgcc gcggtcccag ttctaaagtc cccacgcacc        60
     cacccggact cagagtctcc tcagacgccg agatgctggt catggcgccc cgaaccgtcc       120
     tcctgctgct ctcggcggcc ctggccctga ccgagacctg ggccggtgag tgcgggtcgg       180
     gagggaaatg gcctctgccg ggaggagcga ggggaccgca ggcgggggcg caggacctga       240
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcacccc caggctccca       300
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       360
     ctcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       420
     gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       480
     cacacagatc tacaaggccc aggcacagac tgaccgagag agcctgcgga acctgcgcgg       540
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc       600
     ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcctccctg       660
     aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt ttacccggtt       720
     tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg       780
     actgggctga ccgcggggcc ggggccaggg tctcacaccc tccagagcat gtacggctgc       840
     gacgtggggc cggacgggcg cctcctccgc gggcatgacc agtacgccta cgacggcaag       900
     gattacatcg ccctgaacga ggacctgcgc tcctggaccg ccgcggacac ggcggctcag       960
     atcacccagc gcaagtggga ggcggcccgt gaggcggagc agcggagagc ctacctggag      1020
     ggcgagtgcg tggagtggct ccgcagatac ctggagaacg ggaaggacaa gctggagcgc      1080
     gctggtacca ggggcagtgg ggagccttcc ccatctccta taggtcgccg gggatggcct      1140
     cccacgagaa gaggaggaaa atgggatcag cgctagaatg tcgccctccg ttgaatggag      1200
     aatggcatga gttttcctga gtttcctctg agggccccct cttctctcta gacaattaag      1260
     gaatgacgtc tctgaggaaa tggaggggaa gacagtccct agaatactga tcaggggtcc      1320
     cctttgaccc ctgcagcagc cttgggaacc gtgacttttc ctctcaggcc ttgttctctg      1380
     cctcacactc agtgtgtttg gggctctgat tccagcactt ctgagtcact ttacctccac      1440
     tcagatcagg agcagaagtc cctgttcccc gctcagagac tcgaactttc caatgaatag      1500
     gagattatcc caggtgcctg cgtccaggct ggtgtctggg ttctgtgccc cttccccacc      1560
     ccaggtgtcc tgtccattct caggctggtc acatgggtgg tcctagggtg tcccatgaaa      1620
     gatgcaaagc gcctgaattt tctgactctt cccatcagac cccgcaaaga cacacgtgac      1680
     ccaccacccc atctctgacc atgaggccac cctgaggtgc tgggccctgg gtttctaccc      1740
     tgcggagatc acactgacct ggcagcggga tggcgaggac caaactcagg acactgagct      1800
     tgtggagacc agaccagcag gagatagaac cttccagaag tgggcagctg tggtggtgcc      1860
     ttctggagaa gagcagagat acacatgcca tgtacagcat gaggggctgc cgaagcccct      1920
     caccctgaga tggggtaagg agggggatga ggggtcatat ctcttctcag ggaaagcagg      1980
     agcccttcag cagggtcagg gcccctcatc ttcccctcct ttcccagagc cgtcttccca      2040
     gtccaccgtc cccatcgtgg gcattgttgc tggcctggct gtcctagcag ttgtggtcat      2100
     cggagctgtg gtcgctgctg tgatgtgtag gaggaagagt tcaggtaggg aaggggtgag      2160
     gggtggggtc tgggttttct tgtcccactg ggggtttcaa gccccaggta gaagtgttcc      2220
     ctgcctcatt actgggaagc agcatgcaca caggggctaa cgcagcctgg gaccctgtgt      2280
     gccagcactt actcttttgt gcagcacatg tgacaatgaa ggatggatgt atcaccttga      2340
     tggttgtggt gttggggtcc tgattccagc attcatgagt caggggaagg tccctgctaa      2400
     ggacagacct taggagggca gttggtccag gacccacact tgctttcctc gtgtttcctg      2460
     atcctgccct gggtctgtag tcatacttct ggaaattcct tttgggtcca agactaggag      2520
     gttcctctaa gatctcatgg ccctgcttcc tcccagtgcc ctcacaggac attttcttcc      2580
     cacaggtgga aaaggaggga gctactctca ggctgcgtgt aagtggtggg ggtgggagtg      2640
     tggaggagct cacccacccc ataattcctc ctgtcccacg tctcctgcgg gctctgacca      2700
     ggtcctgttt ttgttctact ccaggcagcg acagtgccca gggctctgat gtgtctctca      2760
     cagcttgaaa aggtgagatt cttggggtct agagtgggtg gggtggcggg tctgggggtg      2820
     ggtggggcag aggggaaagg cctgggtaat ggggattctt tgattgggat gtttcgcgtg      2880
     tgtggtgggc tgtttagagt gtcatcgctt accatgacta accagaattt gttcatgact      2940
     gttgttttct gtagcctgag acagctg                                          2967
//


spacer
spacer