spacer

EBI Dbfetch

ID   HE799692; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HE799692;
XX
DT   01-JUN-2012 (Rel. 113, Created)
DT   01-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele HLA-C*04,
DE   exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Eiz-Vesper B.;
RT   ;
RL   Submitted (01-APR-2012) to the INSDC.
RL   Hannover Medical School, Institute for Transfusion Medicine,
RL   Feodor-Lynen-Strasse 21, 30625, GERMANY.
XX
RN   [2]
RA   Eiz-Vesper B., Verboom M., Immenschuh S., Blasczyk R.;
RT   "New HLA C*04 allele";
RL   Unpublished.
XX
DR   MD5; fb5808a069a9776a7f26425f90a0de3e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..269,370..>545)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I4EP44"
FT                   /db_xref="IMGT/HLA:C*04:118"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:I4EP44"
FT                   /protein_id="CCH14901.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGSLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEA"
FT   exon            1..269
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=2
FT   gap             270..369
FT                   /estimated_length=unknown
FT   exon            370..545
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=3
XX
SQ   Sequence 646 BP; 109 A; 164 C; 200 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnng ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg       420
     agcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer