Dbfetch

ID   HE797789; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HE797789;
XX
DT   28-MAY-2012 (Rel. 112, Created)
DT   25-APR-2014 (Rel. 120, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*27
DE   variant, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Dubois V.;
RT   ;
RL   Submitted (26-MAR-2012) to the INSDC.
RL   EFS Rhone Alpes, Histocompatibility, 1 et 3 rue du Vercors, 69007 Lyon,
RL   FRANCE.
XX
RN   [2]
RX   DOI; 10.1111/tan.12325.
RX   PUBMED; 24611956.
RA   Ducreux S., Favre-Victoire I., Giannoli C., Moskovtchenko P., Dubois V.;
RT   "Three new HLA-B alleles determined by sequence-based typing: B*15:222,
RT   B*15:247, B*27:92";
RL   Tissue Antigens 83(5):361-363(2014).
XX
DR   MD5; 1d1a476aa676ce9730672e8d6c01aeb2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*27:92"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:I4ENX3"
FT                   /protein_id="CCH03681.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYREDLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 174 C; 189 G; 71 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagaat atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtacca ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//