spacer

EBI Dbfetch

ID   HE793380; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   HE793380;
XX
DT   15-MAY-2012 (Rel. 112, Created)
DT   15-MAY-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB5 gene for MHC class II antigen, allele
DE   HLA-DRB5*02, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Anholts J.;
RT   ;
RL   Submitted (15-MAR-2012) to the INSDC.
RL   Leiden University Medical Center, Immunohematology and bloodtransfusion,
RL   Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H., Flink M.J.M.;
RT   "Homo sapiens partial HLA-DRB5 gene for MHC class 2 antigen";
RL   Unpublished.
XX
DR   MD5; 69b006532a68f7e8de22e0af0ab1e209.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*02"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I2G868"
FT                   /db_xref="IMGT/HLA:DRB5*02:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:I2G868"
FT                   /protein_id="CCG80502.1"
FT                   /translation="CFLQQDKYECHFFNGTERVRFLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGAVESFTVQRRVEPEVTVYPARTQTL
FT                   QHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*02"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*02"
FT                   /number=3
XX
SQ   Sequence 652 BP; 126 A; 135 C; 186 G; 105 T; 100 other;
     catgtttctt gcagcaggat aagtatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ttgagcctga ggtgactgtg tatcctgcaa ggacccagac cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca caggcctgat tcagaatgga       540
     gactggacct tccagattct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgacg agccctctca cagtggaatg ga               652
//


spacer
spacer