spacer

EBI Dbfetch

ID   HE793166; SV 1; linear; genomic DNA; STD; HUM; 3086 BP.
XX
AC   HE793166;
XX
DT   21-MAR-2012 (Rel. 112, Created)
DT   25-APR-2014 (Rel. 120, Last updated, Version 2)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*08-EC, exons
DE   1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3086
RA   Vilches C.;
RT   ;
RL   Submitted (14-MAR-2012) to the INSDC.
RL   Vilches C., Immunogenetics-HLA lab, H.U. Puerta de Hierro, Manuel de Falla
RL   1, 28222, SPAIN.
XX
RN   [2]
RX   DOI; 10.1111/tan.12192.
RX   PUBMED; 24033148.
RA   Cisneros E., Martinez-Pomar N., Vilches M., Martin P., de Pablo R.,
RA   Nunez Del Prado N., Nieto A., Matamoros N., Moraru M., Vilches C.;
RT   "Advancing allele group-specific amplification of the complete HLA-C
RT   gene--isolation of novel alleles from three allele groups (C*04, C*07 and
RT   C*08)";
RL   Tissue Antigens 82(4):280-285(2013).
XX
DR   MD5; a3f951c6e67ba7b5d43b4678504ceb8f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3086
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..93,224..493,740..1015,1603..1878,2000..2119,
FT                   2559..2591,2699..2746,2911..>3086)
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT   exon            <1..93
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=1
FT   CDS             join(21..93,224..493,740..1015,1603..1878,2000..2119,
FT                   2559..2591,2699..2746,2911..2915)
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:H8XVX3"
FT                   /db_xref="IMGT/HLA:C*08:62"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:H8XVX3"
FT                   /protein_id="CCG58320.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   intron          94..223
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=1
FT   exon            224..493
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=2
FT   intron          494..739
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=2
FT   exon            740..1015
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=3
FT   intron          1016..1602
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=3
FT   exon            1603..1878
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=4
FT   intron          1879..1999
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=4
FT   exon            2000..2119
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=5
FT   intron          2120..2558
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=5
FT   exon            2559..2591
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=6
FT   intron          2592..2698
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=6
FT   exon            2699..2746
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=7
FT   intron          2747..2910
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=7
FT   exon            2911..>3086
FT                   /gene="HLA-C"
FT                   /allele="C*08-EC"
FT                   /number=8
XX
SQ   Sequence 3086 BP; 585 A; 887 C; 974 G; 640 T; 0 other;
     gattctcccc agacgccgag atgcgggtca tggcgccccg aaccctcatc ctgctgctct        60
     cgggagccct ggccctgacc gagacctggg cctgtgagtg cgaggttggg agggaaacgg       120
     cctctgcgga gaggagcgag gggcccgccc ggcgagggcg caggacccgg ggagccgcgc       180
     agggaggagg gtcgggcggg tctcagcccc tcctcgcccc caggctccca ctccatgagg       240
     tatttctaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat cgcagtgggc       300
     tacgtggacg acacgcagtt cgtgcagttc gacagcgacg ccgcgagtcc aagaggggag       360
     ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga gacacagaag       420
     tacaagcgcc aggcacagac tgaccgagtg agcctgcgga acctgcgcgg ctactacaac       480
     cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgacccc tccccatccc       540
     ccacggacgg cccgggtcgc cccgagtctc ccggtctgag atccaccccg aggctgcgga       600
     acccgcccag accctcgacc ggagagagcc ccagtcacct ttacccggtt tcattttcag       660
     tttaggccaa aatccccgcg ggttggtcgg ggctggggcg gggctcgggg gacggggctg       720
     accacggggg cggggccagg gtctcacacc ctccagagga tgtatggctg cgacgtgggg       780
     ccggacgggc gcctcctccg cgggtataac cagttcgcct acgacggcaa ggattacatc       840
     gccctgaatg aggacctgcg ctcctggacc gccgcggaca aggcggctca gatcacccag       900
     cgcaagtggg aggcggcccg tgaggcggag cagcggagag cctacctgga gggcacgtgc       960
     gtggagtggc tccgcagata cctggagaac gggaagaaga cgctgcagcg cgcgggtacc      1020
     aggggcagtg gggagccttc cccatctcct gtagatctcc cgggatggcc tcccacgagg      1080
     aggggaggaa aatgggatca gcgctggaat atcgccctcc cttgaatgga gaatgggatg      1140
     agttttcctg agtttcttct gagggccccc tctgctctct aggacaatta agggatgaag      1200
     tccttgagga aatggagggg aagacagtcc ctggaatact gatcaggggt cccctttgac      1260
     cactttgacc actgcagcag ctgtggtcag gctgctgacc tttctctcag gccttgttct      1320
     ctgcctcacg ctcaatgtgt ttaaaggttt gattccaact tttctgagtc cttcggcctc      1380
     cactcaggtc aggaccagaa gtcgctgttc ctccctcaga gactagaact ttccaatgaa      1440
     taggagatta tcccaggtgc ctgtgtccag gctggcgtct gggttctgtg cccccttccc      1500
     caccccaggt gtcctgtcca ttctcaggat ggtcacatgg gcactgttgg agtgtcgcaa      1560
     gagagataca aagtgtctga attttctgac tcttcccgtc agaacaccca aagacacacg      1620
     tgacccacca tcccgtctct gaccatgagg ccaccctgag gtgctgggcc ctgggcttct      1680
     accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact caggacaccg      1740
     agcttgtgga gaccaggcca gcaggagatg gaaccttcca gaagtgggca gctgtggtgg      1800
     tgccttctgg agaagagcag agatacacgt gccatgtgca gcacgagggg ctgccagagc      1860
     ccctcaccct gagatggggt aaggaggggg atgaggggtc atgtgtcttc tcagggaaag      1920
     cagaagtcct ggagcccttc agccgggtca gggctgaggc ttgggggtca gggcccctca      1980
     ccttcccctc ctttcccagg gccatcttcc cagcccacca tccccatcgt gggcatcgtt      2040
     gctggcctgg ctgtcctggc tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg      2100
     tgtaggagga agagctcagg tagggaaggg gtgaggagtg gggtctgggt tttcttgtcc      2160
     cactgggagt ttcaagcccc aggtagaagt gtgccccacc tcgttactgg aagcaccatc      2220
     cacacatggg ccatcccagc ctgggaccct gtgtgctagc acttactctg ttgtgaagca      2280
     catgacaatg aaggacagat gtatcacctt gatgattatg gtgttggggt ccttgattcc      2340
     agcattcatg agtcagggga aggtccctgc taaggacaga ccttaggagg gcagttgctc      2400
     cagaacccac agctgctttc cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt      2460
     tctggaaact tctcttgggt ccaagactag gaggttcccc taagatcgca tggccctgcc      2520
     tcctccctgt cccctcacag ggcattttct tcccacaggt ggaaaaggag ggagctgctc      2580
     tcaggctgcg tgtaagtgat ggcggtgggc gtgtggagga gctcacccac cccataattc      2640
     ctcttgtccc acatctcctg cgggctctga ccaggtcttt ttttttgttc taccccagcc      2700
     agcaacagtg cccagggctc tgatgagtct ctcatcgctt gtaaaggtga gattctgggg      2760
     agctgaagtg gtcgggggtg gggcagaggg aaaaggccta ggtaatgggg atcctttgat      2820
     tgggacgttt cgaatgtgtg gtgagctgtt cagagtgtca tcacttacca tgactgacct      2880
     gaatttgttc atgactattg tgttctgtag cctgagacag ctgcctgtgt gggactgaga      2940
     tgcaggattt cttcacacct ttcctttgtg acttcaagag cctctggcat ctctttctgc      3000
     aaaggcatct gaatgtgtct gcgttcctgt tagcataatg tgaggaggtg gagagacagc      3060
     ccacccccgt gtccaccgtg acccct                                           3086
//


spacer
spacer